DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7239 and vers

DIOPT Version :9

Sequence 1:NP_608960.2 Gene:CG7239 / 33809 FlyBaseID:FBgn0031740 Length:459 Species:Drosophila melanogaster
Sequence 2:NP_648545.1 Gene:vers / 39374 FlyBaseID:FBgn0011335 Length:391 Species:Drosophila melanogaster


Alignment Length:273 Identity:47/273 - (17%)
Similarity:103/273 - (37%) Gaps:69/273 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GGQELLDGRGKEKARRYWTPSEEERLYEIWGRDNWRLTRTGKNTIFFGRWAEELRDRFAVDVKPE 89
            |.:|..:....:..|..|....|:.|.::|.:.........||.|.:.:.|.|: .:|.    |.
  Fly   137 GKEEKFEDYYTKTERHVWKKDAEKMLLQLWAQHLKDFRGESKNVIIYRQMAREM-SQFG----PS 196

  Fly    90 --EIQMKVNQTRAKFRQVKKQLQADPSSYATRWKKYDIINRILKNLHRPKNADPL-------PPE 145
              |::.|::....|:|...::::  .:...::|:.:..:..:|..   .|:.|..       |.:
  Fly   197 HTELKTKMDNLSRKYRIEAERVR--ETGVPSKWEHFHKLQALLIG---TKSVDVFEDITAENPAQ 256

  Fly   146 ALLNNRDMTPPRDDASAEQLQQQPQQQSVQQQQQQGLGLASEPSTATYYNSSSNSNHGSSHNNNT 210
            ||.::.|..|       |:|      .|::.:...|       .....:.|...::.........
  Fly   257 ALFSDEDYEP-------EEL------SSLKDEPMAG-------DDGNVFESDMVASKAMKRTRTP 301

  Fly   211 SGGVSFNTELFTDQYDEVVKQEYEDDEYRSIPFQEQLQQYSPA--------------EPAQLLEL 261
            |..:   .|:  .:.||..::|.|||::        ::..||:              ...:|||:
  Fly   302 SPSI---PEI--PEEDEEEEEEEEDDDH--------MKDLSPSPISKCQTKRKASNNHSDRLLEI 353

  Fly   262 QTPQ---QQQQLQ 271
            :..:   ::::||
  Fly   354 EEEKLAIEREKLQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7239NP_608960.2 Myb_DNA-bind_4 39..124 CDD:290549 17/86 (20%)
versNP_648545.1 Myb_DNA-bind_4 151..232 CDD:290549 17/87 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464310
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22666
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.