DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9171 and LARGE1

DIOPT Version :9

Sequence 1:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001349878.1 Gene:LARGE1 / 9215 HGNCID:6511 Length:756 Species:Homo sapiens


Alignment Length:428 Identity:92/428 - (21%)
Similarity:146/428 - (34%) Gaps:125/428 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GDPSQVIGNIGPGGVAEVNNSQSDGGYIVTGDEKELEERVRSLINCFDHDYHQQTLQRGDFWVLQ 197
            |.||:          |:||:...         :|:|.|.....: |::....:.|:.|...:   
Human   418 GCPSE----------ADVNSENL---------QKQLSELDEDDL-CYEFRRERFTVHRTHLY--- 459

  Fly   198 NYVRAEHGDIKCHESITYTTHADYTFLDNLVPLLERWNAPVSIAMHAPGTDFQPTLDSIRYLR-- 260
             ::..|:........:|.........|..|..:.:.|..|:|:|::....:.|..|   ||.:  
Human   460 -FLHYEYEPAADSTDVTLVAQLSMDRLQMLEAICKHWEGPISLALYLSDAEAQQFL---RYAQGS 520

  Fly   261 ECLPGSHLVRAYTTFHIYFGTKHIPKSVPKPHEVFKTGYNCTLPPPYFNVSSGHLYKAQKKLLYP 325
            |.|...|.|    .:||                |:|.|.                       .||
Human   521 EVLMSRHNV----GYHI----------------VYKEGQ-----------------------FYP 542

  Fly   326 VNVGRNIARDSALTHFILASDIELYPNPGLVKKFLEMIARNEQYLRR----------KAPRVFPL 380
            ||:.||:|.....|.::..|||:..|..||.           :|||:          |...:.| 
Human   543 VNLLRNVAMKHISTPYMFLSDIDFLPMYGLY-----------EYLRKSVIQLDLANTKKAMIVP- 595

  Fly   381 AIFEVEENSPVPHDKTELQEFLRTGKAIPFHKRVCASCHGVPKSKEWMSANETDELSVFHIGKRT 445
            |...:......|..|.||...|..|....|...|....|......:|.:|.             |
Human   596 AFETLRYRLSFPKSKAELLSMLDMGTLFTFRYHVWTKGHAPTNFAKWRTAT-------------T 647

  Fly   446 GYYVHW----EPIYIGTHADPHYDER---LSWEGKSDKMPQGYALCVMDYEFHILDNAFLV---H 500
            .|.|.|    ||..:.....|.||.|   ..|    :|:.....|.|.:|||.:|.||:::   |
Human   648 PYRVEWEADFEPYVVVRRDCPEYDRRFVGFGW----NKVAHIMELDVQEYEFIVLPNAYMIHMPH 708

  Fly   501 KPGIKVLK-KDNRRAMLSGKTNQLIRKIIYPELKIMYG 537
            .|...:.| :.|::..:..||   :::....::...||
Human   709 APSFDITKFRSNKQYRICLKT---LKEEFQQDMSRRYG 743

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 77/346 (22%)
LARGE1NP_001349878.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..69
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..109
GT8_LARGE_C 138..417 CDD:133053
Xylosyltransferase activity. /evidence=ECO:0000305|PubMed:22223806 138..413
Glucuronyltransferase activity. /evidence=ECO:0000305|PubMed:22223806 414..756 92/428 (21%)
Glyco_transf_49 473..742 CDD:404735 77/346 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146086
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.