DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9171 and Gxylt2

DIOPT Version :9

Sequence 1:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_001066466.1 Gene:Gxylt2 / 688618 RGDID:1586482 Length:444 Species:Rattus norvegicus


Alignment Length:273 Identity:57/273 - (20%)
Similarity:92/273 - (33%) Gaps:90/273 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 FGTKHIPKSVPKPHEVFKTG-YNCTLPPPYF---NVSSGHLYKAQKKLLYPVNVGRNIARDSALT 339
            |.:..:....|: ||:.|.| |:.....|::   .|:||.:.....::       |:....::|.
  Rat   233 FNSTQLAAMAPE-HEIPKIGWYSRFARHPFYGSAGVNSGVMLMNLTRI-------RSTQFKNSLI 289

  Fly   340 HFILASDIELYPNPGLVKKFLEMIARNEQ-------YLRRKAPRVFPLAIFEVEENSPVPHDKTE 397
            ...||.:..|.|   |.:|:...|...:|       |...:...|||                  
  Rat   290 PTGLAWEEMLLP---LYQKYKNAITWGDQDLLNIIFYFNPECLYVFP------------------ 333

  Fly   398 LQEFLRTGKAIPFHKRVCASCHGVPKSKEWMSANETDELSVFHIGKRTGYYVHWEPIYIGTHADP 462
            .|...|     |.|....::|      ||    .|.:.:||.| |.|..|:              
  Rat   334 CQWNYR-----PDHCMYGSNC------KE----AEREGVSVLH-GNRGVYH-------------- 368

  Fly   463 HYDERLSWEGKSDKMPQGYAL--CVMDYEFHILDNAF--LVHKPGIKVLKKDNRRAMLSGKTNQL 523
                       .||.|...||  .:.|:.|.  ||.|  :.:...:|.|:..:   .|.|:..|:
  Rat   369 -----------DDKQPTFRALYEAIRDFPFR--DNLFQSMYYPLQLKFLETVH---TLCGRIPQV 417

  Fly   524 IRKIIYPELKIMY 536
            ..|.|...::..|
  Rat   418 FLKQIEKTMRRAY 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 56/271 (21%)
Gxylt2XP_001066466.1 GT8_like_2 111..414 CDD:133052 53/255 (21%)
RfaJ 127..396 CDD:224359 49/234 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339843
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.