DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9171 and xxylt1

DIOPT Version :9

Sequence 1:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_005155910.1 Gene:xxylt1 / 449721 ZFINID:ZDB-GENE-120521-2 Length:387 Species:Danio rerio


Alignment Length:186 Identity:38/186 - (20%)
Similarity:66/186 - (35%) Gaps:56/186 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FESEEKQLV------NANADPPAAAAQVADGGAGAPQLANDSGAGAAALGDPSQVIGNIGPGGVA 148
            |.|..|::.      |:|.|....:..:..|     .|.:..||||...|.|.:....:   ...
Zfish    45 FSSTTKRIKETQASHNSNRDDADLSIDIQPG-----HLESRPGAGAELEGKPKRFHALM---MFT 101

  Fly   149 EVNNSQSDGGYIVTGDEKELEERVRSLINCFDHDYHQQTLQRGDFWVLQNYV----RAEHGDIKC 209
            :|:.|.|        .:::.:..:||::.      |.:.|:  |..::.:||    ..|.|:...
Zfish   102 KVDKSLS--------LQQKFQTAMRSMVK------HGRFLE--DEILVLHYVSDLGSQEFGEKML 150

  Fly   210 HE-----SITYTT--HADYTFLDNLVPLLERWNAP---------------VSIAMH 243
            .|     |..|..  |...|..:.|.|::|.....               :|:|||
Zfish   151 PELLLDASFQYEVVFHNVDTLTEKLFPIVEAMQKHFSAGSGAYYSDAIFFLSVAMH 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 11/49 (22%)
xxylt1XP_005155910.1 Glyco_tranf_GTA_type 119..>350 CDD:299700 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.