DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9171 and shams

DIOPT Version :9

Sequence 1:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001097911.1 Gene:shams / 43008 FlyBaseID:FBgn0039273 Length:362 Species:Drosophila melanogaster


Alignment Length:345 Identity:66/345 - (19%)
Similarity:115/345 - (33%) Gaps:116/345 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 LERWNAPVSIAMHAPGTDFQPTLDSIR----------YL--------------RECLPGSHLVRA 271
            |:....|:.|.:.:.|...|.||..|:          ||              ||.|.....::.
  Fly    41 LQTGKPPLYIVVVSCGQRVQETLVMIKSAILFNYDEEYLKFVIFTEDGKGDEFREKLTDWRDIKP 105

  Fly   272 YTTFHIYFGTKHIPKSVPKPHEVFKTGYNCTLPPPYFNVSSGHLYK--AQKKLLYPVNVGRNIAR 334
            :|     |..:.:|...|..:|                |...:|:|  |.::|..|         
  Fly   106 FT-----FDFEILPLKFPSGNE----------------VEWRNLFKPCAAQRLFLP--------- 140

  Fly   335 DSALTHFILASDIELYPNPGLVKKFLEMIARNEQYLRRKAPRVFPLAIFEVEENSPVP-HDKTEL 398
             |.|||.    |..||.:..::  ||..|:...::.::         ..|.:.::..| |:...:
  Fly   141 -SLLTHV----DSLLYVDTDIL--FLSPISDIWRFFKK---------FNETQMSALTPEHENENI 189

  Fly   399 QEFLRTGKAIPFHKRVCASCHGVPKSKEWMSANETDELSVFHIGKRTGYYVHWEPIYIGTHADPH 463
            ..:.|..:. ||:.|:     ||......|:.....|:.             ||...:..|.:  
  Fly   190 GWYNRFARH-PFYGRL-----GVNSGVMLMNLTRMREMK-------------WEQHIVSIHKE-- 233

  Fly   464 YDERLSWEGKSDKM-------PQGYALCVMDYEF---HILDNAFL-VHKPGIKVLKKDNRRAMLS 517
            |..|:.| |..|.:       |....:...:|.:   |.:..:.. :.:.|:||: ..||....|
  Fly   234 YKLRIIW-GDQDIINILFYYHPDKLYIMPCEYNYRPDHCMYMSICNMSQTGVKVI-HGNRGYFHS 296

  Fly   518 GKTNQLIRKIIYPELKIMYG 537
            .:         .|..|.:||
  Fly   297 DR---------QPLFKSIYG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 64/342 (19%)
shamsNP_001097911.1 Glyco_tranf_GTA_type 48..343 CDD:299700 64/338 (19%)
RfaJ 64..>270 CDD:224359 48/273 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447383
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.