DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9171 and Large1

DIOPT Version :9

Sequence 1:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001101909.1 Gene:Large1 / 361368 RGDID:1308895 Length:385 Species:Rattus norvegicus


Alignment Length:298 Identity:52/298 - (17%)
Similarity:93/298 - (31%) Gaps:81/298 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GQKMFTRRNWLLRCSILINVAVILYIGSQLMIGGGNNFSNGGGFLLQEQQQVSM----MQVGSAS 67
            |::.|...:..|.| |.....:.|:.||                 |::.:.||:    .|..|..
  Rat     7 GRRKFLAASLTLLC-IPALTWIYLFAGS-----------------LEDGKPVSLSPLESQAHSPR 53

  Fly    68 SAAQVQQQQQPTPKNQNQVAEIFESEEKQLVNANADPPAAAAQVADGGAGAPQLANDSGAGAAAL 132
            ..|..|::::.......:|.|...:..:||..|....||...     |..:...:.:.|.|    
  Rat    54 YTASSQRERESLEVRVREVEEENRALRRQLSLAQGQSPAHRR-----GNHSKTYSMEEGTG---- 109

  Fly   133 GDPSQVIGNIGPGGVAEVNNSQSDGGYIVTGDEKELE--------ERVRSLINCFDHDYHQQ--T 187
                               :|::....||.|:..|..        |.:...|.|..::..:.  |
  Rat   110 -------------------DSENQRAGIVAGNSSECGQQPAVEKCETIHVAIVCAGYNASRDVVT 155

  Fly   188 LQRGDFWVLQNYVRAEHGDIKCHESITYTTHADYTFLDNLVPLLERWNAPVSIAMHAPGTDFQPT 252
            |.:...:..:|             .:.:...||......|..|.:.|..|      |...||. .
  Rat   156 LVKSVLFHRRN-------------PLHFHLIADSIAEQILATLFQTWMVP------AVRVDFY-N 200

  Fly   253 LDSIRYLRECLPGSHLVRAYTTFHIYFGTKHIPKSVPK 290
            .|.::.....:|..|....|....:.. ||.:|.::.:
  Rat   201 ADELKSEVSWIPNKHYSGIYGLMKLVL-TKTLPANLER 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 16/79 (20%)
Large1NP_001101909.1 RfaJ 136..>359 CDD:224359 22/123 (18%)
GT8_LARGE_C 138..377 CDD:133053 21/121 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339846
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.