DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9171 and Gxylt1

DIOPT Version :9

Sequence 1:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001094357.1 Gene:Gxylt1 / 300173 RGDID:1563062 Length:435 Species:Rattus norvegicus


Alignment Length:405 Identity:83/405 - (20%)
Similarity:123/405 - (30%) Gaps:168/405 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 PPAAAAQ-VADGGAGAPQLANDSGAG--------AAALGDPSQVIGNIGPGGVAEVN-------- 151
            |.||.|. :||||.|..:.|..:|.|        :.:..:|..::    |..|..||        
  Rat    40 PQAAVASWLADGGRGTGRGAGSAGPGRTGRCKEVSLSYWNPYWML----PSDVCGVNCFWEAAFR 100

  Fly   152 -------NSQSDGGYIVTGDEKELEERVRSL------------INCFDHD-YHQQTLQRGDFW-V 195
                   ..:.....:..||  .|||.|..|            ::.|..| .|.....|.|.| .
  Rat   101 YGLKTRPTEKMHLAVVACGD--RLEETVTMLKSALIFSIKPLHVHIFAEDQLHDSFKDRLDSWSF 163

  Fly   196 LQNYVRAEH-----GD----------------------IKCHESITYTTHADYTFL---DNLVPL 230
            ||.:..:.:     .|                      :|..:|:.| ...|..||   |::..|
  Rat   164 LQRFNYSLYPITFPSDSAMEWKKLFKPCASQRLFLPLILKGVDSLLY-VDTDVLFLRPVDDIWSL 227

  Fly   231 LERWNAPVSIAMHAPGTDFQPTLDSIRYLRECLPGSHLVRAYTTFHIYFGTKHIPKSVPKPHEVF 295
            |||:|: ..||..||                                             .||..
  Rat   228 LERFNS-TQIAAMAP---------------------------------------------EHEEP 246

  Fly   296 KTG-YNCTLPPPYF---NVSSGHLYKAQKKLLYPVNVGRNIARDSALTHFILASDIELYPNPGLV 356
            :.| ||.....||:   .|:||.:      |:....:.|...::...|..:...|| |.|   |:
  Rat   247 RVGWYNRFARHPYYGRTGVNSGVM------LMNMTRMRRKYFKNDMTTARLQWGDI-LMP---LL 301

  Fly   357 KKFLEMIARNEQ-------YLRRKAPRVFPL---------------------AIFEVEENSPVPH 393
            ||:...|...:|       |...::..|||.                     .:|.:..|..|.|
  Rat   302 KKYKLNITWGDQDLLNIMFYHNPESLFVFPCQWNYRPDHCIYGSNCREAEEEGVFILHGNRGVYH 366

  Fly   394 DKTE-----LQEFLR 403
            |..:     :.|.||
  Rat   367 DDKQPAFRAMYEALR 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 49/232 (21%)
Gxylt1NP_001094357.1 GT8_like_2 111..411 CDD:133052 66/330 (20%)
RfaJ <183..>340 CDD:224359 42/213 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339840
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.