DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9171 and B4gat1

DIOPT Version :9

Sequence 1:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001099794.1 Gene:B4gat1 / 293667 RGDID:1309541 Length:415 Species:Rattus norvegicus


Alignment Length:358 Identity:92/358 - (25%)
Similarity:152/358 - (42%) Gaps:52/358 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 GDIKCHESITYT----------THADYTFLDNLVPLLERWNAPVSIAMHAPGTDFQPTLDSIRYL 259
            ||.:.:..:..|          |||....|.:|..|||||..|:|:::.|...:.......:.|.
  Rat    77 GDYRVYRGLLKTTMDPNDVILATHASVDNLLHLSGLLERWEGPLSVSVFAATREEAQLATVLAYA 141

  Fly   260 RECLPGSHL--VRAYTTFHIYFGTKHIPKSVPKPHE--VFKTGYNC--------TLPPPYFNVSS 312
            .    .||.  :||....|:...::: ..:||.|.|  .|....:|        .:..|..|.:.
  Rat   142 L----SSHCPEMRARVAMHLVCPSRY-EAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYAL 201

  Fly   313 GHLYKAQKKLLYPVNVGRNIARDSALTHFILASDIELYPNPGLVKKFLEMIARNEQYLRRKAPRV 377
            |      ..:.||.|:.||:||:.|  ::.|..|:::.|:.||.:...||:.::..:  .....|
  Rat   202 G------TNISYPNNLLRNLAREEA--NYALVIDVDMVPSEGLWRSLREMLDQSNHW--DGTALV 256

  Fly   378 FPLAIFEVEENSPVPHDKTELQEFLRTGKAIPFHKRVCASCHGVPKSKEWMSANETDELSVFHIG 442
            .|  .||:.....:|.:|.||.:..:.|:..||:..:|..||.......|::..|...|      
  Rat   257 VP--AFEIRRARRMPMNKNELVQLYQVGEVRPFYYGLCTPCHAPTNYSRWVNLPEESLL------ 313

  Fly   443 KRTGYYV----HWEPIYIGTHADPHYDERLSWEGKSDKMPQGYALCVMDYEFHILDNAFLVHKPG 503
             |..|.|    .|||.|:.....|.:|||....| .:::.|...|.:..:.|.:|:..||||| |
  Rat   314 -RPAYVVPWRDPWEPFYVAGGKVPTFDERFRQYG-FNRISQACELHMAGFNFEVLNEGFLVHK-G 375

  Fly   504 IKVLKKDNRRAMLSGKTNQLIRKIIYPELKIMY 536
            .|...|.:.:.....:.|:::.:....|||..|
  Rat   376 FKEALKFHPQKEAENQRNKILYRQFKQELKARY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 89/349 (26%)
B4gat1NP_001099794.1 Glyco_transf_49 94..408 CDD:404735 88/339 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339834
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.