DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9171 and LARGE2

DIOPT Version :9

Sequence 1:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster
Sequence 2:XP_011518188.1 Gene:LARGE2 / 120071 HGNCID:16522 Length:736 Species:Homo sapiens


Alignment Length:346 Identity:80/346 - (23%)
Similarity:114/346 - (32%) Gaps:87/346 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 CFDHDYHQQTLQRGDFWVLQNYVRAEHGDIKCHESITYTTHADYTFLDNLVPLLERWNAPVSIAM 242
            ||:....|.|:.|    |...::..|....:.|: :|.........|..|..|...|..|:|:|:
Human   402 CFEFRQQQLTVHR----VHVTFLPHEPPPPRPHD-VTLVAQLSMDRLQMLEALCRHWPGPMSLAL 461

  Fly   243 HAPGTDFQPTLDSIRYLRECLPGSHLVRAYTTFHIYFGTKHIPKSVPKPHEVFKTGYNCTLPPPY 307
            :....:.|..|             |.|.|...........:        |.|::.|       | 
Human   462 YLTDAEAQQFL-------------HFVEASPVLAARQDVAY--------HVVYREG-------P- 497

  Fly   308 FNVSSGHLYKAQKKLLYPVNVGRNIARDSALTHFILASDIELYPNPGL---VKKFLEMIARNEQY 369
                           |||||..||:|...|||.::..|||:..|...|   ::..:|.:....  
Human   498 ---------------LYPVNQLRNVALAQALTPYVFLSDIDFLPAYSLYDYLRASIEQLGLGS-- 545

  Fly   370 LRRKAPRVFPLAIFEVEENSPVPHDKTELQEFLRTGKAIPFHKRVCASCHGVPKSKEWMSANETD 434
             ||||..|.| |...:......||.|.||...|..|....|........|.......|..|    
Human   546 -RRKAALVVP-AFETLRYRFSFPHSKVELLALLDAGTLYTFRYHEWPRGHAPTDYARWREA---- 604

  Fly   435 ELSVFHIGKRTGYYVHW----EPIYIGTHADPHYDER---LSW---------EGKSDKMPQGYAL 483
                     :..|.|.|    ||..:.....|.||.|   ..|         :.::.:..|...|
Human   605 ---------QAPYRVQWAANYEPYVVVPRDCPRYDPRFVGFGWNKVAHIVELDAQARQARQPLLL 660

  Fly   484 C--VMDYEFHILDNAFLVHKP 502
            |  :.:||..:|..||.:|.|
Human   661 CPTLQEYELLVLPEAFTIHLP 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 72/312 (23%)
LARGE2XP_011518188.1 GT8_LARGE_C 97..376 CDD:133053
RfaJ 98..>345 CDD:224359
Glyco_transf_49 431..679 CDD:290607 70/309 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146072
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5095
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.