DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9171 and B4GAT1

DIOPT Version :9

Sequence 1:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_006867.1 Gene:B4GAT1 / 11041 HGNCID:15685 Length:415 Species:Homo sapiens


Alignment Length:367 Identity:96/367 - (26%)
Similarity:155/367 - (42%) Gaps:70/367 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 GDIKCHESITYT----------THADYTFLDNLVPLLERWNAPVSIAMHAPGTDFQPTLDSIRYL 259
            ||.:.:..:..|          |||....|.:|..|||||..|:|:::.| .|..:..|.::  |
Human    77 GDYRVYRGLLKTTMDPNDVILATHASVDNLLHLSGLLERWEGPLSVSVFA-ATKEEAQLATV--L 138

  Fly   260 RECLPGSHL--VRAYTTFHIYFGTKHIPKSVPKPHE-------------------VFKTGYNCTL 303
            ...| .||.  :||....|:...::: ..:||.|.|                   |.:.|.|..|
Human   139 AYAL-SSHCPDMRARVAMHLVCPSRY-EAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYAL 201

  Fly   304 PPPYFNVSSGHLYKAQKKLLYPVNVGRNIARDSALTHFILASDIELYPNPGLVKKFLEMIARNEQ 368
            ..   |||            ||.|:.||:||:.|  ::.|..|:::.|:.||.:...||:.::.|
Human   202 GT---NVS------------YPNNLLRNLAREGA--NYALVIDVDMVPSEGLWRGLREMLDQSNQ 249

  Fly   369 YLRRKAPRVFPLAIFEVEENSPVPHDKTELQEFLRTGKAIPFHKRVCASCHGVPKSKEWMSANET 433
            :    ......:..||:.....:|.:|.||.:..:.|:..||:..:|..|........|::..|.
Human   250 W----GGTALVVPAFEIRRARRMPMNKNELVQLYQVGEVRPFYYGLCTPCQAPTNYSRWVNLPEE 310

  Fly   434 DELSVFHIGKRTGYYV----HWEPIYIGTHADPHYDERLSWEGKSDKMPQGYALCVMDYEFHILD 494
            ..|       |..|.|    .|||.|:.....|.:|||....| .:::.|...|.|..::|.:|:
Human   311 SLL-------RPAYVVPWQDPWEPFYVAGGKVPTFDERFRQYG-FNRISQACELHVAGFDFEVLN 367

  Fly   495 NAFLVHKPGIKVLKKDNRRAMLSGKTNQLIRKIIYPELKIMY 536
            ..||||| |.|...|.:.:.....:.|:::.:....|||..|
Human   368 EGFLVHK-GFKEALKFHPQKEAENQHNKILYRQFKQELKAKY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 93/358 (26%)
B4GAT1NP_006867.1 Glyco_transf_49 94..408 CDD:404735 92/348 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146077
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D485184at33208
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5095
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.