DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9171 and B4gat1

DIOPT Version :9

Sequence 1:NP_001162891.1 Gene:CG9171 / 33807 FlyBaseID:FBgn0031738 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_780592.1 Gene:B4gat1 / 108902 MGIID:1919680 Length:415 Species:Mus musculus


Alignment Length:358 Identity:96/358 - (26%)
Similarity:156/358 - (43%) Gaps:52/358 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 GDIKCHESITYT----------THADYTFLDNLVPLLERWNAPVSIAMHAPGTDFQPTLDSIRYL 259
            ||.:.:..:..|          |||....|.:|..|||||..|:|:::.| .|..:..|.::  |
Mouse    77 GDYRVYRGLLKTTMDPNDVILATHASVDNLLHLSGLLERWEGPLSVSVFA-ATKEEAQLATV--L 138

  Fly   260 RECLPGSHL--VRAYTTFHIYFGTKHIPKSVPKPHE--VFKTGYNC--------TLPPPYFNVSS 312
            ...| .||.  :||....|:...::: ..:||.|.|  .|....:|        .:..|..|.:.
Mouse   139 AYAL-SSHCPEMRARVAMHLVCPSRY-EAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYAL 201

  Fly   313 GHLYKAQKKLLYPVNVGRNIARDSALTHFILASDIELYPNPGLVKKFLEMIARNEQYLRRKAPRV 377
            |      ....||.|:.||:||:.|  ::.|..|:::.|:.||.:...||:.::..:  .....|
Mouse   202 G------TNTSYPNNLLRNLAREEA--NYALVIDVDMVPSEGLWRGLREMLDQSNHW--DGTALV 256

  Fly   378 FPLAIFEVEENSPVPHDKTELQEFLRTGKAIPFHKRVCASCHGVPKSKEWMSANETDELSVFHIG 442
            .|  .||:..:..:|.:|.||.:..:.|:..||:..:|..||.......|::..|...|      
Mouse   257 VP--AFEIRRSRRMPMNKNELVQLYQVGEVRPFYYGLCTPCHAPTNYSRWVNLPEESLL------ 313

  Fly   443 KRTGYYV----HWEPIYIGTHADPHYDERLSWEGKSDKMPQGYALCVMDYEFHILDNAFLVHKPG 503
             |..|.|    .|||.|:.....|.:|||....| .:::.|...|.|..:.|.:|:..||||| |
Mouse   314 -RPAYVVPWRDPWEPFYVAGGKVPTFDERFRQYG-FNRISQACELHVAGFNFEVLNEGFLVHK-G 375

  Fly   504 IKVLKKDNRRAMLSGKTNQLIRKIIYPELKIMY 536
            .|...|.:.:.....:.|:::.:....|||..|
Mouse   376 FKEALKFHPQKEAENQRNKILYRQFKQELKARY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9171NP_001162891.1 Glyco_transf_49 212..536 CDD:290607 93/349 (27%)
B4gat1NP_780592.1 Glyco_transf_49 94..408 CDD:290607 92/339 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836175
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6619
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D729091at2759
OrthoFinder 1 1.000 - - FOG0003642
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5095
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.