DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and CG17147

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:284 Identity:62/284 - (21%)
Similarity:93/284 - (32%) Gaps:87/284 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKILISALL-CVAMFGSMALGSP--ECPTPNGRFASGDQ------CDSYTECQDGTPVEKLCPD 56
            |..:.:..|| ||.:..::||.:.  |.......|.:|.:      ||.|.:|.||......||.
  Fly     1 MLNLKLGVLLGCVLLLATVALSASVGEYEELCRLFKNGTKVRKPGTCDQYIQCYDGNGTVLTCPS 65

  Fly    57 GLLFHQRTKATGECTYAPYSTCKERARLQPANGTEECPRQFGFYPNG-------DATKCGVYRNC 114
            ...|:   .:.|.|.    .|.        ||..:.|    |....|       |.|:|..|..|
  Fly    66 NQSFN---PSKGSCV----DTL--------ANSNKYC----GNRCEGLDGEWVADPTECHKYFYC 111

  Fly   115 AHGVASLTKCPEGLAFNEET------------------------------------YQCD--WPD 141
            .:||.....||.|..|:|.:                                    |:||  ...
  Fly   112 MNGVPLAGMCPVGQHFDERSQSCLYGVDSMCVDVNNICELVAENTKFRNEKDCAYYYECDKTGNH 176

  Fly   142 LVESCNAEA----YLGF---NCPAADSADDSAAAAVDVSPEGELRYYRHPQ-TCKKYFVC----- 193
            ..:||...:    |...   ||..|:..:.:|.:..:|........::..| ||:.||||     
  Fly   177 ASKSCTVTSKKREYFDVESGNCVEANKVECTAHSKENVCTSSTTMTFKSDQATCRGYFVCKALYP 241

  Fly   194 -VNGHPRLYNCGKYLAFNSQTKLC 216
             .:..|....|.:...|:...:||
  Fly   242 VADLDPLWTQCPEGYFFDEDRQLC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 12/49 (24%)
CBM_14 95..146 CDD:307643 17/95 (18%)
CBM_14 180..225 CDD:307643 12/44 (27%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 10/35 (29%)
ChtBD2 89..136 CDD:214696 13/46 (28%)
CBM_14 278..332 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.