DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and CG7290

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:243 Identity:57/243 - (23%)
Similarity:85/243 - (34%) Gaps:55/243 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKILISALLCVAMFGSMALGSPECPTP---------------NGRF-ASGDQCDSYTECQDGTPV 50
            |.||.:..|.:|           |..|               ||.: ||...|.:|.:||..:..
  Fly     6 ATILAAVALVIA-----------CAAPAIADVNVTALCLLVSNGNYVASQSDCSTYYQCQGSSFT 59

  Fly    51 EKLCPDGLLFHQRTKATGECTYAPYSTCKERARLQPANGTEECPRQFGFYPNGDATKCGVYRNCA 115
            ...||.|..|.:..:   :||....|||...:  .|..|     :..|.:. ..::.||.|..|.
  Fly    60 AMSCPQGYYFDKNAQ---QCTGTVPSTCTSNS--DPCLG-----KAVGSFA-ASSSSCGGYYYCG 113

  Fly   116 HGVASLTKCPEGLAFNEETYQCDWPDLVESCNAEAYLGFNCPAADSADDSAAAAVDVSPEGELR- 179
            ...|....||.|..||..|..|.:.:             |.|.::||.|.:..:|.::....:: 
  Fly   114 ASGAVRGNCPAGENFNPTTMACVYKN-------------NYPCSESAGDGSTVSVALNLCNLVKN 165

  Fly   180 --YYRHPQTCKKYFVCVNGHPRLYNCGKYLAFNSQTKLCDFYNKVPEC 225
              |:..|..|..:..|.:......:|...|.||.|...|. |.....|
  Fly   166 GFYFGSPSDCSGWNFCQDNVLHSGSCEDGLVFNVQASNCG-YKMASSC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 14/57 (25%)
CBM_14 95..146 CDD:307643 13/50 (26%)
CBM_14 180..225 CDD:307643 11/44 (25%)
CG7290NP_001262093.1 CBM_14 32..77 CDD:279884 12/47 (26%)
CBM_14 91..142 CDD:279884 15/69 (22%)
CBM_14 160..207 CDD:279884 10/47 (21%)
CBM_14 234..277 CDD:279884
ChtBD2 <296..331 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.