DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and obst-H

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:295 Identity:67/295 - (22%)
Similarity:98/295 - (33%) Gaps:84/295 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAKILISALLCVAMFGSMALGS---PECP-TPNGRFA-SGDQCDSYTECQDGTPVEKLCPDGLLF 60
            |:|.||.  ||:.:..|..:.:   .||. ..:|.|. |.:.|.||..|:....::..|.||..|
  Fly     1 MSKYLIH--LCLVLLWSSRINADHFDECDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDGEYF 63

  Fly    61 HQRTKATGECTYAPYSTC-----KERARLQPANGTEE---------------------------- 92
            ...   .|.|..|...:|     .|.:..:|....||                            
  Fly    64 DSE---AGTCDIAANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAP 125

  Fly    93 -----C-----PRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVESCN 147
                 |     |.|..|..:.::  |..|..|.||.|....|...|.||..|.|||:||.|:   
  Fly   126 VVRPNCPISDDPGQVIFMASNNS--CTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQ--- 185

  Fly   148 AEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCGKYLAFNSQ 212
                    |...|.........:       ..::.||..|..::.|:.|...|..|..|..::.:
  Fly   186 --------CAFEDPRSHKCLPHM-------TEFFPHPDNCNYFYYCIKGFLTLQQCPFYYGWDIE 235

  Fly   213 TKLCDFYNKVPECYA----------LLKEKQRLKA 237
            .:.| ....|.:||.          |...||.:|:
  Fly   236 RRSC-VQIGVAKCYGNSRRIGRKAPLPPRKQLIKS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 13/43 (30%)
CBM_14 95..146 CDD:307643 19/50 (38%)
CBM_14 180..225 CDD:307643 10/44 (23%)
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 15/53 (28%)
CBM_14 142..184 CDD:279884 17/43 (40%)
ChtBD2 203..240 CDD:214696 9/37 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.