DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and CG10725

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:207 Identity:57/207 - (27%)
Similarity:82/207 - (39%) Gaps:17/207 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CVAMFGSMALGSPECPTPN-GRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAP 74
            ||.:.....:||  |.... ..|.....|..|..|.|||||.:.|.|||   |....|..|.|..
  Fly    71 CVPLMEVECIGS--CKNRGLSSFCYDRTCTKYVLCFDGTPVIRQCSDGL---QYNALTDRCDYPQ 130

  Fly    75 YSTCKERARLQPANGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDW 139
            |..|.:....:..|     |....|.|:  ..:|..|..|..|:..:..|..||.:|..|..||:
  Fly   131 YVDCVDNLCSRNNN-----PDDIVFIPS--KARCDKYYICMDGLPQVQNCTSGLQYNPSTQSCDF 188

  Fly   140 PDLVESCNAEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCG 204
            |..| :|..|:......|.|.:  ....|.::...|| ..:..|.:....|:.|:||.....:|.
  Fly   189 PSKV-NCTVESLQRNILPFARA--PPRLADIECPSEG-AHFIAHQKRQDAYYYCLNGRGVTLDCT 249

  Fly   205 KYLAFNSQTKLC 216
            ..|.|:::.:.|
  Fly   250 PGLVFDAKREEC 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 15/42 (36%)
CBM_14 95..146 CDD:307643 15/50 (30%)
CBM_14 180..225 CDD:307643 9/37 (24%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 1/1 (100%)
CBM_14 83..134 CDD:279884 19/53 (36%)
CBM_14 150..192 CDD:279884 14/43 (33%)
ChtBD2 216..264 CDD:214696 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.