DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and CG10154

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001189089.1 Gene:CG10154 / 39509 FlyBaseID:FBgn0036361 Length:316 Species:Drosophila melanogaster


Alignment Length:208 Identity:62/208 - (29%)
Similarity:80/208 - (38%) Gaps:42/208 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GRFASG------DQCDSYTECQDGTPVE-----KLCPDGLLFHQRTKATGECTYAP---YSTCKE 80
            |..|.|      ..|..|.||::.|..|     .|..|........|:. |..|.|   ..|..|
  Fly    59 GNVADGVYLPYVGNCSKYIECENNTIKEVGSCLDLAKDNPDICDPNKSC-ELGYDPVLQVCTYME 122

  Fly    81 RARLQPANGTEECPRQFGF-YPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVE 144
            ..:..|   |.|..|...| |.|    .|..|..|.:|...|.:|.:||.:|..|.:||:|:.|:
  Fly   123 EVQCLP---TCESFRLSSFCYDN----TCTKYVLCYYGKPVLRQCHDGLQYNNATDRCDFPEYVD 180

  Fly   145 SCNAEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCGKYLAF 209
                       |.|.|       .:....|| ::.|.....:|.||:||.||||....|...||:
  Fly   181 -----------CVAND-------CSATFQPE-DIIYLGSKASCSKYYVCSNGHPWEQQCAPGLAY 226

  Fly   210 NSQTKLCDFYNKV 222
            |...|.|||...|
  Fly   227 NPSCKCCDFAKNV 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 11/45 (24%)
CBM_14 95..146 CDD:307643 18/51 (35%)
CBM_14 180..225 CDD:307643 19/43 (44%)
CG10154NP_001189089.1 CBM_14 130..180 CDD:279884 18/53 (34%)
CBM_14 197..239 CDD:279884 18/41 (44%)
ChtBD2 263..311 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.