DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and CG17826

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648528.1 Gene:CG17826 / 39354 FlyBaseID:FBgn0036227 Length:751 Species:Drosophila melanogaster


Alignment Length:302 Identity:69/302 - (22%)
Similarity:89/302 - (29%) Gaps:121/302 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LCVAMFGSMALGSPECP----TPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGEC 70
            :||...|...  .|.|.    |||     .|.|..|.||.||..|...||||..|:   .....|
  Fly    69 ICVVDDGQCR--PPTCVDGEITPN-----PDDCAGYLECVDGIIVILTCPDGDYFN---STLNRC 123

  Fly    71 TYAPYSTCKERARLQPANGTEECPRQFGFYPNG----DATKCGVYRNCAHGVASLTKCPEGLAFN 131
            .......|.       .||| .|       .:|    |.|.|..|..|::|.....:|.:|..||
  Fly   124 VEDTCGVCN-------GNGT-TC-------TDGELKVDPTNCAGYLACSNGNWVSKQCADGAYFN 173

  Fly   132 EETYQCDWPD-------------------LVESCNAEAYLGFNCPAADSA----DDSAAAAVD-- 171
            .....|...|                   :.|.|:...|:..:|   ||.    ..|....||  
  Fly   174 AILETCVQDDEGICVNCKEGSTKPLADCTMYEICSGGKYVTKSC---DSGYYWNSQSEVCDVDNG 235

  Fly   172 -------VSPEGELRYYRHPQTCKKYFVCVNGH-------------------------------- 197
                   ...:|||:.  .|..|..|..|.||:                                
  Fly   236 QCNGNGTTCTDGELKV--DPTNCAGYLACSNGNWVSKQCADGAYFNVTLETCVQDDEGICVNCKE 298

  Fly   198 ---PRLYNC--------GKYLA--------FNSQTKLCDFYN 220
               ..|.:|        |||:.        :|||:::||..|
  Fly   299 GSTKPLADCTMYEICSGGKYVTKSCDSGYYWNSQSEVCDVDN 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 18/45 (40%)
CBM_14 95..146 CDD:307643 14/73 (19%)
CBM_14 180..225 CDD:307643 17/92 (18%)
CG17826NP_648528.1 CBM_14 36..74 CDD:279884 2/4 (50%)
ChtBD2 <89..124 CDD:214696 15/42 (36%)
CBM_14 145..184 CDD:279884 11/38 (29%)
CBM_14 251..290 CDD:279884 6/40 (15%)
CBM_14 357..396 CDD:279884
CBM_14 463..502 CDD:279884
CBM_14 563..610 CDD:279884
CBM_14 621..670 CDD:279884
CBM_14 697..749 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.