DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and CG5897

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:260 Identity:48/260 - (18%)
Similarity:82/260 - (31%) Gaps:98/260 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CVAMFGSMALGSPECPTPNGRFASGDQCDSYTECQDGTPVE-KLCPDGLLFHQRTKATGECTYAP 74
            |....|:..:|.|            ..|.::..|||...:: :.|.:|||:..|   .|.|..|.
  Fly    29 CKLWAGTGYIGDP------------SDCQAWGYCQDNKLIDRRSCTEGLLYSFR---DGTCKRAS 78

  Fly    75 YSTCKER-----ARLQP---------------------------------ANGTEECPRQFGFYP 101
            .:.|..:     |.|:|                                 :|..:.|..:....|
  Fly    79 DTICHSQLSEICASLEPWNYVANPADCRRFVKCADLDDPTWGDCGVGQVFSNKKQTCLEEVAGCP 143

  Fly   102 N-------------GDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVESCNAEAYLG 153
            .             ||...|.:|..|.:|..::..|..|..||.:|..|           ::::.
  Fly   144 QDNICSHMKDGSFVGDPKSCQIYYKCHNGFGTMLNCSVGRYFNRKTGNC-----------QSWMP 197

  Fly   154 FNCPAADSADDSAAAAVDVSPEGEL--RYYRHPQ----------TCKKYFVCVNGHPRLYNCGKY 206
            ..|    |.||........|.:..:  :||:..:          ||..|:.|.:    .::.||:
  Fly   198 HYC----SKDDEDNILTPPSTDHNICSKYYQRDRDGVQLLPDLMTCYGYYSCTS----QFDVGKW 254

  Fly   207  206
              Fly   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 10/42 (24%)
CBM_14 95..146 CDD:307643 13/63 (21%)
CBM_14 180..225 CDD:307643 8/37 (22%)
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.