DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and Muc68D

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_648504.2 Gene:Muc68D / 39326 FlyBaseID:FBgn0036203 Length:1514 Species:Drosophila melanogaster


Alignment Length:249 Identity:60/249 - (24%)
Similarity:91/249 - (36%) Gaps:45/249 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SPECPTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAPYSTCKERARLQP 86
            :||.|..:|..:|....:..|.|....| :|........|...|.|.|...|..||.|......|
  Fly  1242 APENPGDSGNSSSESPPEGATPCTPNAP-KKSTTSSYTAHPTPKYTTEGNKAETSTLKSPTGTTP 1305

  Fly    87 ANGTEECPRQFGFYPNG----DATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVESCN 147
              |.:|........|||    |...|..|..|.:|.|....||..|.|:.:...|::|.||:   
  Fly  1306 --GHQEDRTDCSNMPNGIFLRDFQSCNKYYVCLNGKAIAGHCPRNLHFDIKRKVCNFPSLVD--- 1365

  Fly   148 AEAYLGFNCPAADSADDSAAAAVDVSPEGELR------YYRHPQTCKKYFVCVNGHPRLYNCGKY 206
                    ||..::.::......|.....:.:      |.|.|::|.:::||.||......|.:.
  Fly  1366 --------CPLDEAPENVTKKPSDTESTPDCKSLRNGAYVRDPKSCSRFYVCANGRAIPRQCPQG 1422

  Fly   207 LAFNSQTKLCDF--------------------YNKVPECYALLKEKQRLKAEKQ 240
            |.|:.::..|::                    ...||:| ..:||..|....||
  Fly  1423 LHFDIKSNFCNYPILVQCSLEESQADAHGALLAEGVPDC-TKVKEDTRFGDVKQ 1475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 10/41 (24%)
CBM_14 95..146 CDD:307643 17/54 (31%)
CBM_14 180..225 CDD:307643 14/64 (22%)
Muc68DNP_648504.2 ChtBD2 21..69 CDD:214696
PHA03249 1088..>1209 CDD:223023
CBM_14 1314..1366 CDD:279884 17/62 (27%)
CBM_14 1388..1440 CDD:279884 12/51 (24%)
ChtBD2 1459..1505 CDD:214696 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.