DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and CG32302

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:254 Identity:54/254 - (21%)
Similarity:86/254 - (33%) Gaps:88/254 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ECPTPN---------GRFASGDQCDSYTECQD---GTPVEKLCPDGLLFHQRTKATGECTYAPYS 76
            :|..|.         |.|.....|..|.||.|   .||  ::|.:|..:   :..||.|.....|
  Fly    82 QCQVPKRGPFSCQQAGLFPDPYDCRRYHECSDQSVDTP--RICSNGAGY---STLTGTCVLPRES 141

  Fly    77 TCKERARLQPANGTEEC-PRQF---------GFYPNGDATKCGVYRNCAHGVAS-----LTKCPE 126
                          |:| ..||         |:.|:.     ..:..|.:..|:     :.||.|
  Fly   142 --------------EQCIQEQFTCSRSGQVGGWAPDN-----RYFYVCVNDTANSLYPLMMKCHE 187

  Fly   127 GLAF------------------------NEETYQCDW-PDLVESC---NAEAYLGFNCPAADSAD 163
            |..|                        |.:.|||.: ...:|.|   :.|..: ..|||....|
  Fly   188 GFVFNSYSCVPDTRSMRSIQAMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEV-MTCPAGFQID 251

  Fly   164 DSAAAAVD----VSPEGELRYYRHPQTCKKYFVCVNGHPRLYNC--GKYLAFNSQTKLC 216
            ......|.    ...:.|:....:..|..:|.:|::...::|:|  |:|  ||::|:.|
  Fly   252 PKILTCVTDRIYQCSDFEILSCPNVSTKDEYCICIDHQLQIYSCPMGQY--FNAETRKC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 13/52 (25%)
CBM_14 95..146 CDD:307643 16/89 (18%)
CBM_14 180..225 CDD:307643 11/39 (28%)
CG32302NP_728732.1 CBM_14 94..144 CDD:279884 16/68 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.