DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and CG31077

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster


Alignment Length:310 Identity:77/310 - (24%)
Similarity:94/310 - (30%) Gaps:94/310 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CPTPNGRFASGD------QCDSYTECQDGTPVEKLCPDGLLFHQRTK-----ATGECTYAPYSTC 78
            |||.......||      .|.||.:|..|..|.:.||.|..|:..:|     .||.|. :|...|
  Fly    85 CPTSRRLCFDGDIFEDINDCMSYVKCIRGDLVRQRCPAGSNFNVISKNCQMSRTGSCA-SPKEIC 148

  Fly    79 KE----------RARLQPANG---TEECPRQFGFYP---------NG----------------DA 105
            .|          ...|:..||   .|:||....|.|         ||                |.
  Fly   149 LEGELQVDSEDCAGYLECLNGGLVKEKCPIGSYFEPIFKLCQLDENGVCSSSSSECTDGEVRVDP 213

  Fly   106 TKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVESC-----------------NAEAYLG 153
            ..|..|.||.:|......||.|..| |.||:....||...|                 |...||.
  Fly   214 NNCAGYFNCENGRLITKTCPSGTYF-EPTYKTCTVDLKGVCVEPPAKCTEGQLKIDPNNCAGYLK 277

  Fly   154 F--------NCPAADSAD--------DSAAAAVDVSP---EGELRYYRHPQTCKKYFVCVNGHPR 199
            .        .||.....|        |:....|.:..   || || .:.|:.|..|..|:.|...
  Fly   278 CIDGEFVEEKCPGGTYYDFKLETCLVDTEGVCVTIRKLCIEG-LR-EKDPKDCAAYTQCIRGRVE 340

  Fly   200 LYNC--GKYLAFNSQTKLCDFYNKVPECYALLKEKQRLKAEKQQPQVAQP 247
            ...|  |:|........|.|.|.   .|....||..|:....|..:...|
  Fly   341 SVMCDSGRYFNVTQGECLADLYE---VCLKSRKEHFRIVEHHQYDESTTP 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 15/45 (33%)
CBM_14 95..146 CDD:307643 19/75 (25%)
CBM_14 180..225 CDD:307643 11/46 (24%)
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696 13/33 (39%)
CBM_14 267..308 CDD:279884 7/40 (18%)
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884
CBM_14 881..914 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.