DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and Muc68E

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster


Alignment Length:213 Identity:51/213 - (23%)
Similarity:78/213 - (36%) Gaps:50/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SPECPT---PNGRFASGDQ-------CDSYTECQDGTPVEKLCPDGLLF-HQRTKATGECTYAPY 75
            |||..|   |....::|.|       |..|..|.:|..:...||..|.: :.:...:|:.     
  Fly  1613 SPETTTSSLPPLSCSTGYQYLPHPTNCHKYIHCSNGHELIMECPANLYWDYHKFVCSGDS----- 1672

  Fly    76 STCKERARLQPANGTEEC-PRQFGFYPNGD----ATKCGVYRNCAHGVASLTKCPEGLAFNEETY 135
            ..|        .|.||.. |.:....|..|    .|.|.:|..|::|||...|||:.|.:|.|..
  Fly  1673 GVC--------YNDTENSNPEEKVCGPGVDFLAHPTDCTMYLQCSNGVALERKCPDPLYWNPEIK 1729

  Fly   136 QCDWPDLVESC-NAEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPR 199
            .|||.:  :.| |..|....:|.|.                  :.:......|.||..|......
  Fly  1730 SCDWSN--KYCTNLRASQSISCAAG------------------MNFNVFQSDCSKYVKCFGLRGV 1774

  Fly   200 LYNCGKYLAFNSQTKLCD 217
            :.:|...|.:|..:::|:
  Fly  1775 VMSCNSGLYWNPVSQVCE 1792

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 13/52 (25%)
CBM_14 95..146 CDD:307643 18/54 (33%)
CBM_14 180..225 CDD:307643 8/38 (21%)
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 7/29 (24%)
ChtBD2 1626..1668 CDD:214696 9/41 (22%)
ChtBD2 1688..1734 CDD:214696 17/45 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.