DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and CG33263

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_996072.1 Gene:CG33263 / 2768952 FlyBaseID:FBgn0053263 Length:227 Species:Drosophila melanogaster


Alignment Length:216 Identity:53/216 - (24%)
Similarity:80/216 - (37%) Gaps:49/216 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PECP-TPNGRFASG-DQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAPYSTCKERARLQ 85
            |:|. .|...|... :.|.||..|.........||:...|..||:   ||.:.....|   .|..
  Fly    26 PQCANAPLDTFVMAIEDCASYIYCNGEDSFRDSCPESTYFDDRTQ---ECAFDDEGVC---LRNS 84

  Fly    86 PANGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCP--------EGLAFNEETYQCD---- 138
            .:..|||.|         |....|..::   |:...|..|        .|.| :..|:|.|    
  Fly    85 DSVQTEEQP---------DKQTTGEEQS---GIEETTPVPTPPSDYASTGSA-DSSTFQADSTTT 136

  Fly   139 ----WPDLVESCNAEAYLGFNCPAADSADDSAAAA----VDVSPEGELRYYRHPQTCKKYFVCVN 195
                .|.:.|.....|     .|::.||..|:.|.    .|:|.:|:   :.|||.|:.|:.|::
  Fly   137 PTESIPSVTEPPTTSA-----TPSSPSAKPSSPAQERPHCDISGDGD---HPHPQRCEYYYRCLS 193

  Fly   196 GHPRLYNCGKYLAFNSQTKLC 216
            |:..:..|.....::..||.|
  Fly   194 GYLTIVRCPYKYGWDFPTKQC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 12/43 (28%)
CBM_14 95..146 CDD:307643 12/66 (18%)
CBM_14 180..225 CDD:307643 11/37 (30%)
CG33263NP_996072.1 CBM_14 28..79 CDD:279884 14/53 (26%)
CBM_14 171..222 CDD:279884 14/47 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.