DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and C39D10.7

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_509334.3 Gene:C39D10.7 / 181050 WormBaseID:WBGene00016534 Length:1171 Species:Caenorhabditis elegans


Alignment Length:258 Identity:65/258 - (25%)
Similarity:98/258 - (37%) Gaps:57/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILISALLCVAMFGSMALG--SPECPTPNGRFASGDQCDS-YTECQDGTPVEKLCPDGLLFH---- 61
            |..:|::.::......|.  .|.||..:|.:|.|  |.| |.:|.:....|:.||:||.|.    
 Worm     6 IFAAAVILISADAKNVLNPKGPPCPDGDGLYAVG--CSSKYLQCVNNVEYEQSCPEGLYFDRLLA 68

  Fly    62 --QRTKATGECTYAPYSTCKERARLQPANGTEEC-PRQFGFYPNGDATKCGV-YRNCAHGVASLT 122
              :|..:...|......|...|.:....|    | .|..|.|.. |.|.|.. |..||:|::.:.
 Worm    69 RCERRSSNHLCATGDRVTLNVRQKAVSIN----CVGRLSGDYAL-DKTVCNENYYQCANGISYMR 128

  Fly   123 KCPEGLAFNEETYQCDWPDLVESCNAEAYLGFNCPAADSADDSAAAA------------------ 169
            |||         ||..:..:::.|:...    ||.|:....|.||||                  
 Worm   129 KCP---------YQQVYVPILKRCDYHT----NCNASGGVKDQAAAAYASPTYDSDNYIVTTKEF 180

  Fly   170 ------VDVSPEGELRYYRHPQTCKKYF-VCVNGHPRLYNCGKYLAFNSQTKLCDFYNKVPEC 225
                  :|....|::.:..:.: |..|| .|.||......|.:.|.:.....||||...|.:|
 Worm   181 ENGHNGLDCKVTGDMHFTDNVK-CSPYFWQCSNGKLFRKTCPEKLIYVLDQNLCDFPESVKDC 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 17/48 (35%)
CBM_14 95..146 CDD:307643 15/51 (29%)
CBM_14 180..225 CDD:307643 13/45 (29%)
C39D10.7NP_509334.3 CBM_14 29..79 CDD:279884 16/51 (31%)
CBM_14 98..148 CDD:279884 17/63 (27%)
CBM_14 189..242 CDD:279884 14/53 (26%)
ChtBD2 337..384 CDD:214696
CBM_14 419..467 CDD:279884
CBM_14 560..612 CDD:279884
CBM_14 675..726 CDD:279884
CBM_14 774..825 CDD:279884
CBM_14 875..927 CDD:279884
CBM_14 941..992 CDD:279884
CBM_14 1010..1062 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.