Sequence 1: | NP_723116.1 | Gene: | obst-E / 33806 | FlyBaseID: | FBgn0031737 | Length: | 249 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498171.1 | Gene: | R02F2.4 / 175755 | WormBaseID: | WBGene00019833 | Length: | 431 | Species: | Caenorhabditis elegans |
Alignment Length: | 202 | Identity: | 49/202 - (24%) |
---|---|---|---|
Similarity: | 78/202 - (38%) | Gaps: | 40/202 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 NGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAPYSTCKERARLQPANGTEEC 93
Fly 94 PRQFGFYPNGDA----TKC-GVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVESCNAEAYLG 153
Fly 154 FNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCGKYLAFNSQTKLCDF 218
Fly 219 YNKVPEC 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
obst-E | NP_723116.1 | ChtBD2 | 23..65 | CDD:214696 | 10/35 (29%) |
CBM_14 | 95..146 | CDD:307643 | 18/55 (33%) | ||
CBM_14 | 180..225 | CDD:307643 | 11/44 (25%) | ||
R02F2.4 | NP_498171.1 | CBM_14 | 25..74 | CDD:279884 | |
ChtBD2 | 117..165 | CDD:214696 | 12/57 (21%) | ||
CBM_14 | 185..229 | CDD:279884 | 15/43 (35%) | ||
ChtBD2 | 240..283 | CDD:214696 | 10/60 (17%) | ||
CBM_14 | 310..361 | CDD:279884 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_2CXJD | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |