DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and R02F2.4

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:202 Identity:49/202 - (24%)
Similarity:78/202 - (38%) Gaps:40/202 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAPYSTCKERARLQPANGTEEC 93
            :|.::||....||..|..|:|....|...|::....|   :|::              ....:||
 Worm   124 DGVYSSGTCSSSYIICNSGSPRFLSCSTPLIYDPTNK---KCSW--------------KGMIDEC 171

  Fly    94 PRQFGFYPNGDA----TKC-GVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVESCNAEAYLG 153
            .:..|.|...|.    ::| .|:.:|:.|:|....||..|.||.....||||..|..|:.::...
 Worm   172 SQVSGEYCESDGNISKSECSNVFFSCSEGIAHRRNCPANLVFNPAISSCDWPKNVMDCSEKSEKP 236

  Fly   154 FNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCGKYLAFNSQTKLCDF 218
            .||...|.                  |:...:....:..|.||.|.:..|...|.|:.:.::||:
 Worm   237 QNCGEVDG------------------YFSFGRCSSSFSACTNGIPIVMFCPDGLMFSEKNQMCDY 283

  Fly   219 YNKVPEC 225
            ...|.||
 Worm   284 EWNVDEC 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 10/35 (29%)
CBM_14 95..146 CDD:307643 18/55 (33%)
CBM_14 180..225 CDD:307643 11/44 (25%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884
ChtBD2 117..165 CDD:214696 12/57 (21%)
CBM_14 185..229 CDD:279884 15/43 (35%)
ChtBD2 240..283 CDD:214696 10/60 (17%)
CBM_14 310..361 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CXJD
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.