DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment obst-E and cpg-1

DIOPT Version :9

Sequence 1:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001021159.1 Gene:cpg-1 / 175586 WormBaseID:WBGene00000465 Length:584 Species:Caenorhabditis elegans


Alignment Length:225 Identity:59/225 - (26%)
Similarity:82/225 - (36%) Gaps:41/225 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ECPT-PNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAPYSTCKERARLQPA 87
            :|.| .:|.:|.|.....:..|..|......||..|::..|..|   |.|: |:..:.....|..
 Worm    60 DCSTKEDGLYAIGGCSPQFLTCSGGISRIMDCPADLIYDPRIVA---CEYS-YNVPQCGGVPQDV 120

  Fly    88 NGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCP-EGLAFNEET----------YQC---- 137
            ..|:|.      ||:.:.|.     |....|...|..| |.:...|||          |..    
 Worm   121 TSTQEA------YPSEETTV-----NPYAPVEEATTTPAEDVTVPEETTTEAYAPVDDYSTTTPA 174

  Fly   138 -DWPDLVESCNAEAYLGF-----NCPAADSADDSAAAAVDVSPEGEL-RYYRHPQTCKKYFVCVN 195
             |.|..||: .|..|...     ..||||  :....:||..|..|:. .:|...:....|..|.|
 Worm   175 EDVPVPVET-TASPYAPIVPYTTGAPAAD--EPVTRSAVTKSCVGKADGFYSFGECSDHYTACSN 236

  Fly   196 GHPRLYNCGKYLAFNSQTKLCDFYNKVPEC 225
            |:.....|...|||:....:||:...||||
 Worm   237 GYLIPMQCPARLAFDEARVICDYVMNVPEC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 11/41 (27%)
CBM_14 95..146 CDD:307643 16/66 (24%)
CBM_14 180..225 CDD:307643 13/44 (30%)
cpg-1NP_001021159.1 CBM_14 61..113 CDD:279884 15/55 (27%)
CBM_14 214..266 CDD:279884 14/51 (27%)
CBM_14 <537..576 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.