DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11030 and AT1G07840

DIOPT Version :9

Sequence 1:NP_001260103.1 Gene:CG11030 / 33805 FlyBaseID:FBgn0031736 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_563798.1 Gene:AT1G07840 / 837299 AraportID:AT1G07840 Length:312 Species:Arabidopsis thaliana


Alignment Length:346 Identity:107/346 - (30%)
Similarity:155/346 - (44%) Gaps:80/346 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QDIPQAIQLLGEMNSNVKQVTDLVEGMLQRVKRGELTTEYGLSFLEVKYHMLLDYLINLTYVVLR 78
            ::.||...:|.||.:.:..|...||.:...||.....|..|:|:||.|:.:||.|..:|.|.:||
plant    15 KEAPQLASVLREMKNVLDVVRSKVEALTALVKANSFPTAGGISYLEAKHLLLLSYCQDLVYYILR 79

  Fly    79 KCSGETIEGDPSIERLIEIRTVLEKIRPIDHKLRYQIDKLVKTATTG----------------VS 127
            |..|.:|:|.|.:..|:|||..||||||||.||:|||.||   .|.|                ..
plant    80 KAKGLSIDGHPLVRSLVEIRMFLEKIRPIDKKLQYQIQKL---TTAGGPVTELAHSEGKGSCEAQ 141

  Fly   128 SSTDPILYKPNPDDMMSSAGGAGRDEDDGEDDSDEEDEDDDEEDEDEAGAAKMPRKAATAGKSGV 192
            .|.|...|||.||.:                    .|::||:||:                  ||
plant   142 KSEDLSNYKPKPDLL--------------------ADKEDDQEDD------------------GV 168

  Fly   193 YVPPRIKPVYYDG----DERDADKEKKALDRAKKRAITSSMLQDLKEEYLDAPTEISS----GSR 249
            |.||:..|:..:.    .||||.:::|...|   :|..::.::|:.::..|.|.||..    .|.
plant   169 YRPPKFAPMSMEDKTSKQERDAARKEKHFFR---QATENTYMKDVLDDLEDRPEEIRDYYGVESN 230

  Fly   250 AQQMLSQAQKEKQEYEETYLMRLPVTKAEKHRQRKLTT---LGTLGDEILGEISRESALRGDGSK 311
            .|:......:.:|:.||....|.|.||.:|.|:::|.:   |..|.:....:|   ..|..||.|
plant   231 EQKRFMAQYERQQKAEEELFTRAPRTKEDKKREKRLKSSSGLHELTENFYDDI---KFLDKDGEK 292

  Fly   312 KRKLAKKGKGKKRGG--KKRK 330
            .|...:    .||||  ||||
plant   293 PRSFGR----NKRGGPFKKRK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11030NP_001260103.1 Sas10_Utp3 23..103 CDD:397897 31/79 (39%)
AT1G07840NP_563798.1 Sas10_Utp3 24..103 CDD:281929 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I3536
eggNOG 1 0.900 - - E1_KOG3117
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H44286
Inparanoid 1 1.050 129 1.000 Inparanoid score I1896
OMA 1 1.010 - - QHG57207
OrthoDB 1 1.010 - - D1511802at2759
OrthoFinder 1 1.000 - - FOG0003463
OrthoInspector 1 1.000 - - oto3627
orthoMCL 1 0.900 - - OOG6_102932
Panther 1 1.100 - - LDO PTHR13237
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3923
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.