DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and metN

DIOPT Version :10

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_414741.1 Gene:metN / 944896 ECOCYCID:EG11621 Length:343 Species:Escherichia coli


Alignment Length:233 Identity:62/233 - (26%)
Similarity:113/233 - (48%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEVRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLG 68
            :::.|..|.:...:.....||.::::|..|.|||::||||.||:||:.|:....|...|.|:|.|
E. coli     2 IKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDG 66

  Fly    69 AK---PGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIY------GLTDERIREKFKLLK 124
            .:   ..|........::|.:.|...|:...||      ||.:.      ....:.::.:...|.
E. coli    67 QELTTLSESELTKARRQIGMIFQHFNLLSSRTV------FGNVALPLELDNTPKDEVKRRVTELL 125

  Fly   125 ELLQLPPARQMI-KQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNS 188
            .|:.|....... ...||||::|::.|.|:..:|::|:.||.|..|||.....|.:.|.:..|..
E. coli   126 SLVGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRL 190

  Fly   189 KLAVIITTHYIEEAKQ-ANCIGLMRNGVLLAEDTPTNI 225
            .|.:::.||.::..|: .:|:.::.||.|:.:||.:.:
E. coli   191 GLTILLITHEMDVVKRICDCVAVISNGELIEQDTVSEV 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 4..245 CDD:440746 62/233 (27%)
ABC2_membrane_3 322..702 CDD:463674
YadH 513..710 CDD:440604
metNNP_414741.1 metN 1..343 CDD:236863 62/233 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.