DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and Abca2

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_006233707.2 Gene:Abca2 / 79248 RGDID:620238 Length:2435 Species:Rattus norvegicus


Alignment Length:275 Identity:83/275 - (30%)
Similarity:143/275 - (52%) Gaps:26/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEVRNGYKYYGSKSNPKIV-LNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVL 67
            |::.|..|.|.|:...:|: :::|.:.|..|..:||||.:|.|||:....:.|.....|||..|.
  Rat  2052 VKIENLTKVYKSRKIGRILAVDRLCLGVRPGECFGLLGVNGAGKTSTFKMLTGDESTTGGEAFVN 2116

  Fly    68 GAKPGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGL--TDER--IR---EKFKLLKE 125
            |....:....|..| :|:.||..||.:|:|.:|.:..:.|:.|:  .||.  :|   ||.:|.| 
  Rat  2117 GHSVLKDLLQVQQS-LGYCPQFDALFDELTAREHLQLYTRLRGIPWKDEAQVVRWALEKLELTK- 2179

  Fly   126 LLQLPPARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKL 190
                 .|.:.....|||.:|:||.|.|:|..|..:.|||||.|:||..|..:|:.:::..:..: 
  Rat  2180 -----CADKPAGSYSGGNKRKLSTAIALIGYPAFIFLDEPTTGMDPKARRFLWNLILDLIKTGR- 2238

  Fly   191 AVIITTHYIEEAKQANC--IGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLILSQRQGNEDELAQ 253
            :|::|:|.:||. :|.|  :.:|.||.|....:..::..:||     |.::|..:.:.:::....
  Rat  2239 SVVLTSHSMEEC-EAVCTRLAIMVNGRLRCLGSIQHLKNRFG-----DGYMITVRTKSSQNVKDV 2297

  Fly   254 IMDHNKNQALPAAVL 268
            :...|:|  .|.|:|
  Rat  2298 VRFFNRN--FPEAML 2310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 83/275 (30%)
P-loop_NTPase 4..222 CDD:304359 74/227 (33%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
Abca2XP_006233707.2 rim_protein 1..2369 CDD:130324 83/275 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.