DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and abca3b

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_009297489.1 Gene:abca3b / 564344 ZFINID:ZDB-GENE-050517-2 Length:1703 Species:Danio rerio


Alignment Length:278 Identity:83/278 - (29%)
Similarity:144/278 - (51%) Gaps:40/278 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLG------AK 70
            |.|.:|  .:.:::|::.|.:|..:||||.:|.||||....:.|...:..|:..:.|      .|
Zfish  1387 YSGGQS--LLAVDRLSLAVGKGECFGLLGFNGAGKTTTFKMLTGDESITSGDAFIDGYSILTDVK 1449

  Fly    71 PGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKF------KLLKELLQL 129
            ..:       .|:|:.||..|:::.||.:||:..:.|:.|     |.||:      .:|:.||..
Zfish  1450 KVQ-------QRIGYCPQFDAVLDHMTGRETLSMYARLRG-----IPEKYVTACVENVLRSLLLE 1502

  Fly   130 PPARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVII 194
            |.|.::::..|||.:|:||...|:|..|.::.||||:.|:||:.|..:|| .:..||.|..|:||
Zfish  1503 PHADKLVRSYSGGNKRKLSAGMALIGGPPVIFLDEPSTGMDPVARRLLWD-AITRTRESGKAIII 1566

  Fly   195 TTHYIEEAKQANC--IGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLILS----QRQGNEDELAQ 253
            |:|.:||. :|.|  :.:|.||......:|.::..|||:     .:.:|:    :.:..|.:|..
Zfish  1567 TSHSMEEC-EALCTRLAVMVNGQFKCLGSPQHLKSKFGS-----GYTLLAKVRVETELEESDLQL 1625

  Fly   254 IMDHNKNQALPAAVLPPE 271
            ..|..:: ..|.::|..|
Zfish  1626 FKDFIES-TFPGSLLKDE 1642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 83/278 (30%)
P-loop_NTPase 4..222 CDD:304359 72/223 (32%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
abca3bXP_009297489.1 AAA 1..>95 CDD:333001
AAA <122..1695 CDD:333001 83/278 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.