DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and abca8

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_031749971.1 Gene:abca8 / 549630 XenbaseID:XB-GENE-1005441 Length:1619 Species:Xenopus tropicalis


Alignment Length:267 Identity:78/267 - (29%)
Similarity:136/267 - (50%) Gaps:17/267 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLGA 69
            :|:.|..::  |.|.|.....::..|.:|.:.||||.:|.||||.:..:.|:.|...|||::.|.
 Frog  1280 KVKKGKSFF--KKNKKAATKNISFCVRKGEVLGLLGPNGAGKTTSIYMLAGEIRPTAGEVLLCGT 1342

  Fly    70 KPGEPGSGV--PGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFKLLKELLQLPP- 131
            .|.:..:..  |...:|:.||:..|...:|||:.:..:..:.||..:......|.:.|.|:|.. 
 Frog  1343 DPDKSQNSQYDPTGSLGYCPQDNPLWPNLTVKQHLEIYAAVKGLKKKDAETAIKRVSEALELKEH 1407

  Fly   132 ARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITT 196
            ..:..::.|.|..|::.||.:|:.:|.:::||||:.||||..::::|..:....||.....|:||
 Frog  1408 LEKAARKLSAGVSRKVCFAISMLGNPNIVLLDEPSTGLDPKGQQRLWRAIRSAFRNKDRGAILTT 1472

  Fly   197 HYIEEAKQANC--IGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLILSQRQGNE-----DELAQI 254
            ||:||| :|.|  :.:|.:|.|....:...:..|||    :...|.:..:..|:     :|:.||
 Frog  1473 HYMEEA-EAVCDRVAIMVSGKLRCIGSIQQLKSKFG----KGYLLEIKVKNSNQVDQIHNEIIQI 1532

  Fly   255 MDHNKNQ 261
            ..|...|
 Frog  1533 FPHAARQ 1539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 78/267 (29%)
P-loop_NTPase 4..222 CDD:304359 68/221 (31%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
abca8XP_031749971.1 rim_protein <225..1601 CDD:130324 78/267 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 90 1.000 Domainoid score I7652
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.