DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and abca4

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001011033.1 Gene:abca4 / 496442 XenbaseID:XB-GENE-1000810 Length:2359 Species:Xenopus tropicalis


Alignment Length:316 Identity:84/316 - (26%)
Similarity:143/316 - (45%) Gaps:56/316 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EVRNGYKYYGSKSNP--------------------------KIVLNQLNMNVMRGSIYGLLGASG 43
            ::::|:.|.|   ||                          |..::::|:....|.|...||.:|
 Frog   973 DMKDGFTYIG---NPFFEPEPPGMVPGVYIQDLVKVYENTYKPAVDRMNITFYEGQITAFLGHNG 1034

  Fly    44 CGKTTLLSCIVGQRRLNGGEVVVLGAKPGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRI 108
            .||||.||.|.|......|.|.|.|.........:..| :|..||...|...:||:|.|.::.::
 Frog  1035 AGKTTTLSIITGLFPPTSGTVWVRGRDIQTHMDSIRQS-LGMCPQHNILFRHLTVEEHILFYAQL 1098

  Fly   109 YGLTDERIREKFKLLKELLQLPPAR-QMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPM 172
            .|.:.::...:.:::.|.:.:|..| ...:..|||.||:||.|.|.:.:.::::|||||.|:||.
 Frog  1099 KGKSRKQAERQAEVMLEDMGIPHKRNDEAQNLSGGMQRKLSVALAFVGESKVVVLDEPTSGVDPY 1163

  Fly   173 LREKIWDFLVETTRNSKLAVIITTHYIEEAK-QANCIGLMRNGVLLAEDTPTNIMIKFGTQSIED 236
            .|..|||.|::  ..|...:|::||:::||. ..:.|.::..|.|....:|..:...|||    .
 Frog  1164 SRRSIWDLLLK--YRSGRTIILSTHHMDEADLLGDRIAIVSQGKLFCSGSPLFLKNCFGT----G 1222

  Fly   237 AFLILSQRQGNEDELAQIMDHNKNQ--------ALPAAVLPPEVIDTHEPNMPEKQ 284
            .:|.|.:|..|      |.|..|..        :.|.:...|:|    :.|:.|::
 Frog  1223 FYLTLVRRMRN------IKDTGKKDSASCQSDCSCPCSSCTPKV----KENLLEQE 1268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 83/312 (27%)
P-loop_NTPase 4..222 CDD:304359 68/244 (28%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
abca4NP_001011033.1 rim_protein 1..2347 CDD:130324 84/316 (27%)
ABC2_membrane 604..>778 CDD:304374
ABC_subfamily_A 997..1216 CDD:213230 64/221 (29%)
ABC_subfamily_A 2013..2233 CDD:213230
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.