DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and CG8908

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_611464.3 Gene:CG8908 / 37293 FlyBaseID:FBgn0034493 Length:1626 Species:Drosophila melanogaster


Alignment Length:315 Identity:80/315 - (25%)
Similarity:142/315 - (45%) Gaps:55/315 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLG-- 68
            ::|..|.|||    .:.:..|.:::......||||.:|.||:::...|||...:..|.:.:.|  
  Fly  1244 LKNLSKRYGS----FVAVRSLTLDLNPFECVGLLGRNGSGKSSIFRMIVGMESITVGSIHIKGYS 1304

  Fly    69 --AKPGEPGSGVPGSR-VGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFKLLKELLQL- 129
              .:|.:      .|| |||.|:|:.|:..||.|:.:.:...|.|:..|.|:.....|.|..:| 
  Fly  1305 LKTRPKD------ASRHVGFCPRELMLLSFMTGKDALRFCCLINGIRREYIKSLVASLAECFELV 1363

  Fly   130 PPARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVII 194
            |...:.|...|.|.:|:|..|...: .|.|:.|||||.|:|...:.:||..| :..|....::::
  Fly  1364 PHMNKRISTYSNGTKRKLMIAMGTL-APSLMCLDEPTAGVDMHAKYEIWSIL-DGIRQGGRSILL 1426

  Fly   195 TTHYIEEAK-QANCIGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLILSQRQGNEDELAQIMDHN 258
            |||.:||.: ....:|:|.:|.||...:.:.:..:|      :..:.:..:.|...|    ||..
  Fly  1427 TTHNLEECEFLCTNVGIMDHGSLLCYGSLSRLKHRF------NMGIFVKVKMGTRAE----MDDE 1481

  Fly   259 KNQALPAAVLPP-----------------EVIDTHEPNMPEKQPIPFEEPLNENR 296
            ::..:...::||                 .::..|.|      |:   ||:.::|
  Fly  1482 RDNWMQITMMPPNDSEMGSTVGARRMMLAHLLRHHNP------PV---EPVKKSR 1527

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 76/299 (25%)
P-loop_NTPase 4..222 CDD:304359 67/222 (30%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
CG8908NP_611464.3 ABC2_membrane_3 69..394 CDD:289468
LivG 471..686 CDD:223488
ABC_subfamily_A 474..691 CDD:213230
ABC2_membrane_3 845..1192 CDD:289468
NatA 1242..1461 CDD:226927 67/228 (29%)
ABC_subfamily_A 1242..1459 CDD:213230 67/226 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.