DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and Abca12

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_237242.6 Gene:Abca12 / 301482 RGDID:1304586 Length:2595 Species:Rattus norvegicus


Alignment Length:271 Identity:81/271 - (29%)
Similarity:142/271 - (52%) Gaps:28/271 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLGAKPGEPGS-GVPGSRVG 84
            |.:|.:::.:..|..:||||.:|.||||:...:.|....:.|.:::.. |.|..|. ....|.||
  Rat  2271 IAVNNISLGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRN-KSGSLGHVDSHSSLVG 2334

  Fly    85 FMPQEIALVEEMTVKETIFYFGRIYGLTDERIREK-FKLLKELLQLPPARQMIKQCSGGQQRRLS 148
            :.|||.||.:.:||:|.::::.|::|:.::.|:|. .|||:.|..:....:....||.|.:|:||
  Rat  2335 YCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMAYKDRSTSMCSYGTKRKLS 2399

  Fly   149 FACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITTHYIEEAKQANC--IGLM 211
            .|.|:|..|.:|:||||:.|:||..:..:|..:.|..:| |.:||:|:|.:||. :|.|  :.:|
  Rat  2400 TALALIGKPSILLLDEPSSGMDPKSKRHLWRIISEEVQN-KCSVILTSHSMEEC-EALCTRLAIM 2462

  Fly   212 RNGVLLAEDTPTNIMIKFGTQSIEDAFLILSQRQGNE---DELAQIMD------HNKNQALPAAV 267
            .||......:..:|..:||.     .|.:....:.|:   :.|.:.|.      :.|:|.|    
  Rat  2463 VNGRFQCIGSLQHIKSRFGR-----GFTVKVHLKNNKVSMENLTKFMQLHFPKTYLKDQHL---- 2518

  Fly   268 LPPEVIDTHEP 278
               .:::.|.|
  Rat  2519 ---SMLEYHVP 2526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 81/271 (30%)
P-loop_NTPase 4..222 CDD:304359 69/204 (34%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
Abca12XP_237242.6 ABC2_membrane_3 <1006..1267 CDD:289468
NosY <1108..1269 CDD:224196
ZnuC 1346..1570 CDD:224046
ABC_subfamily_A 1350..1565 CDD:213230
ABC2_membrane_3 <1913..2174 CDD:289468
CcmA 2253..2567 CDD:224054 81/271 (30%)
ABC_subfamily_A 2254..2477 CDD:213230 69/208 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.