DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and Abca7

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_997481.1 Gene:Abca7 / 299609 RGDID:1303134 Length:2170 Species:Rattus norvegicus


Alignment Length:329 Identity:85/329 - (25%)
Similarity:151/329 - (45%) Gaps:59/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEVRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLG 68
            |.:|...|::  :.:|:..|..||::...|.|...||.:|.||||.||.:.|....:.|...:||
  Rat   805 VSIRGLKKHF--RGSPQPALRGLNLDFYEGHITAFLGHNGAGKTTTLSILSGLFPPSSGSASILG 867

  Fly    69 ---------AKPGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERI-REKFKLL 123
                     .:|          .:|..||...|.:.:||:|.::::||:.|::...| .|:..|:
  Rat   868 HDVQTNMAAIRP----------HLGICPQYNVLFDMLTVEEHVWFYGRLKGVSAAAIDSEQEHLI 922

  Fly   124 KELLQLPPARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNS 188
            :::..:|......:..|||.||:||.|.|.:....::|:||||.|:||..|..||:.|::.....
  Rat   923 RDVGLIPKRDTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLLKYREGR 987

  Fly   189 KLAVIITTHYIEEAK-QANCIGLMRNGVLLAEDTPTNIMIKFG----------TQSI-------- 234
            .|  |::||:::||: ..:.:.::.:|.|....:|..:....|          :||:        
  Rat   988 TL--ILSTHHLDEAELLGDRVAMVASGSLCCCGSPLFLRRHLGCGYYLTLVKSSQSLVTHDLKGD 1050

  Fly   235 -EDAFLILSQRQGNEDELAQIM-----DHNKNQ--------ALPAAVLPPEVIDTHEPNMPEKQP 285
             ||.  ...::.|:|.:.|..:     .|..:|        ..|:|.|..|::..|.|.....:.
  Rat  1051 TEDP--RREKKSGSEGKTADTVLTRDGPHRSSQVPAPDAVPVTPSAALILELVQRHVPGAQLVEE 1113

  Fly   286 IPFE 289
            :|.|
  Rat  1114 LPHE 1117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 83/320 (26%)
P-loop_NTPase 4..222 CDD:304359 66/228 (29%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
Abca7NP_997481.1 rim_protein 1..2127 CDD:130324 85/329 (26%)
ABC2_membrane <557..742 CDD:304374
ABC_subfamily_A 805..1024 CDD:213230 67/232 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1044..1086 7/43 (16%)
ABC_subfamily_A 1818..2038 CDD:213230
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2129..2170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.