DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and Abca3

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001034670.1 Gene:Abca3 / 27410 MGIID:1351617 Length:1704 Species:Mus musculus


Alignment Length:274 Identity:82/274 - (29%)
Similarity:142/274 - (51%) Gaps:11/274 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLGAKPGEPG 75
            |.|..:: |.:.::::::.|.:|..:||||.:|.||||....:.|:..:..|:..| |.......
Mouse  1388 KVYDQRA-PLLAVDRISLAVQKGECFGLLGFNGAGKTTTFKMLTGEETITSGDAFV-GGYSISSD 1450

  Fly    76 SGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFK-LLKELLQLPPARQMIKQC 139
            .|....|:|:.||..||::.||.:|.:..:.|:.|:.:..|....: .|:.||..|.|.:::|..
Mouse  1451 IGKVRQRMGYCPQFDALLDHMTGREMLVMYARLRGIPERLINACVENTLRGLLLEPHANKLVKTY 1515

  Fly   140 SGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITTHYIEEAKQ 204
            |||.:|:||...|:|.:|.::.||||:.|:||:.|..:|| .|...|.|..|::||:|.:||. :
Mouse  1516 SGGNKRKLSTGIALIGEPAVIFLDEPSTGMDPVARRLLWD-TVARARESGKAIVITSHSMEEC-E 1578

  Fly   205 ANC--IGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLILSQRQGNEDELAQIMDHNKNQALPAAV 267
            |.|  :.:|..|......:|.::..|||:.....|.:....:|...:|....:|    ...|.::
Mouse  1579 ALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLQAKVRSEGKQDALEEFKAFVD----LTFPGSI 1639

  Fly   268 LPPEVIDTHEPNMP 281
            |..|..|....::|
Mouse  1640 LEDEHQDMVHYHLP 1653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 82/274 (30%)
P-loop_NTPase 4..222 CDD:304359 69/213 (32%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
Abca3NP_001034670.1 rim_protein 1..>43 CDD:130324
rim_protein <206..1699 CDD:130324 82/274 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.