DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and Abca8b

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_038879.2 Gene:Abca8b / 27404 MGIID:1351668 Length:1620 Species:Mus musculus


Alignment Length:294 Identity:84/294 - (28%)
Similarity:145/294 - (49%) Gaps:34/294 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLGAKPGEPG 75
            |:..||...||....::..|.:|.|.||||.:|.||:|.|..|.|..::..|:|::.|::.|:  
Mouse  1292 KHCLSKKKAKIATRNVSFCVRKGEILGLLGHNGAGKSTSLKMISGDTKVTAGQVLLKGSREGD-- 1354

  Fly    76 SGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDE-------RIREKFKLLKELLQLPPAR 133
              .||. :|:.|||.||...:||||.:..|..:.||...       |:.:..||..:|      :
Mouse  1355 --TPGF-LGYCPQENALWPNLTVKEHLEIFAAVRGLRKSHAAVAITRLADALKLQDQL------K 1410

  Fly   134 QMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITTHY 198
            ..:|..|.|.:|:|.|..:::.:|.:|:||||:.||||..:::||..:....:|:....::||||
Mouse  1411 SPVKTLSEGVKRKLCFVLSILGNPSILLLDEPSTGLDPEGQQQIWQAIRAIIKNTDRGALLTTHY 1475

  Fly   199 IEEAKQANC--IGLMRNGVLLAEDTPTNIMIKFGTQ-SIEDAFLILSQRQGNEDELAQIMDHNKN 260
            :.|| :|.|  :.::.:|.|....:..::..|||.. .:|.....|.|.:....|:.::......
Mouse  1476 MAEA-EALCDRVAILVSGRLRCIGSIQHLKSKFGKDYLLEMKVKTLEQVEPLNTEILRLFPQASR 1539

  Fly   261 QALPAAVLPPEVIDTHEPNMPEKQPIPFEEPLNE 294
            |            :.:...|..|.|:...:||::
Mouse  1540 Q------------ERYSSLMAYKLPVEAVQPLSQ 1561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 80/280 (29%)
P-loop_NTPase 4..222 CDD:304359 71/219 (32%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
Abca8bNP_038879.2 rim_protein <265..1596 CDD:130324 84/294 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5976
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.