DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and Abca7

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001334010.1 Gene:Abca7 / 27403 MGIID:1351646 Length:2167 Species:Mus musculus


Alignment Length:342 Identity:81/342 - (23%)
Similarity:143/342 - (41%) Gaps:80/342 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLGAK 70
            :|:..|.|..:.||.:  ::|.:.:..|..:||||.:|.|||:....:.|....:.||.|:.|..
Mouse  1817 LRDLTKVYRGQRNPAV--DRLCLGIPPGECFGLLGVNGAGKTSTFRMVTGDTLPSSGEAVLAGHN 1879

  Fly    71 PGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFKLLKELLQLPP-ARQ 134
            ..:..|....| :|:.||..|:.:.:|.:|.:..|.|:.|:.:.::.:........|.||. |.:
Mouse  1880 VAQERSAAHRS-MGYCPQSDAIFDLLTGREHLELFARLRGVPEAQVAQTALSGLVRLGLPSYADR 1943

  Fly   135 MIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITTHYI 199
            .....|||.:|:|:.|.|::.||.::.|||||.|:||..|..:|:.|:...|..: :|::|:|.:
Mouse  1944 PAGTYSGGNKRKLATALALVGDPAVVFLDEPTTGMDPSARRFLWNSLLSVVREGR-SVVLTSHSM 2007

  Fly   200 EEAKQANC--IGLMRNG----------------------VLLAEDTP------------------ 222
            ||. :|.|  :.:|.||                      :.:..|.|                  
Mouse  2008 EEC-EALCTRLAIMVNGRFRCLGSSQHLKGRFGAGHTLTLRVPPDQPEPAIAFIRITFPGAELRE 2071

  Fly   223 ------------------TNIMIKFGTQ--------------SIEDAFLILSQRQGNEDELAQIM 255
                              |.:..:...|              ::|:.||..|:.||.|:|.::..
Mouse  2072 VHGSRLRFQLPPGGRCTLTRVFRELAAQGRAHGVEDFSVSQTTLEEVFLYFSKDQGEEEESSRQE 2136

  Fly   256 DHNKNQALPAAVLPPEV 272
            ...:..:.|....|..|
Mouse  2137 AEEEEVSKPGRQHPKRV 2153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 81/342 (24%)
P-loop_NTPase 4..222 CDD:304359 67/240 (28%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
Abca7NP_001334010.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1042..1088
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1172..1192
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2126..2167 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.