DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and ABCA12

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_011509253.1 Gene:ABCA12 / 26154 HGNCID:14637 Length:2598 Species:Homo sapiens


Alignment Length:214 Identity:73/214 - (34%)
Similarity:124/214 - (57%) Gaps:7/214 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLGAKPGEPGS-GVPGSRVG 84
            |.:|.:::.:..|..:||||.:|.||||:...:.|....:.|.:::.. |.|..|. ....|.||
Human  2274 IAVNNISIGIPAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRN-KTGSLGHVDSHSSLVG 2337

  Fly    85 FMPQEIALVEEMTVKETIFYFGRIYGLTDERIREK-FKLLKELLQLPPARQMIKQCSGGQQRRLS 148
            :.|||.||.:.:||:|.::::.|::|:.::.|:|. .|||:.|..:|...:....||.|.:|:||
Human  2338 YCPQEDALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMPFKDRATSMCSYGTKRKLS 2402

  Fly   149 FACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITTHYIEEAKQANC--IGLM 211
            .|.|:|..|.:|:||||:.|:||..:..:|..:.|..:| |.:||:|:|.:||. :|.|  :.:|
Human  2403 TALALIGKPSILLLDEPSSGMDPKSKRHLWKIISEEVQN-KCSVILTSHSMEEC-EALCTRLAIM 2465

  Fly   212 RNGVLLAEDTPTNIMIKFG 230
            .||......:..:|..:||
Human  2466 VNGKFQCIGSLQHIKSRFG 2484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 73/214 (34%)
P-loop_NTPase 4..222 CDD:304359 70/204 (34%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
ABCA12XP_011509253.1 ABC2_membrane_3 <1026..1270 CDD:289468
ZnuC 1349..1573 CDD:224046
ABC_subfamily_A 1353..1568 CDD:213230
ABC2_membrane_3 <1916..2177 CDD:289468
ABC_subfamily_A 2257..2480 CDD:213230 70/208 (34%)
CcmA 2262..2570 CDD:224054 73/214 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.