DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and ABCA3

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001080.2 Gene:ABCA3 / 21 HGNCID:33 Length:1704 Species:Homo sapiens


Alignment Length:266 Identity:83/266 - (31%)
Similarity:141/266 - (53%) Gaps:13/266 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLGAKPGEPGSGVPGSRV 83
            |.:.:::|::.|.:|..:||||.:|.||||....:.|:..|..|:..|.|.:... ..|....|:
Human  1395 PLLAVDRLSLAVQKGECFGLLGFNGAGKTTTFKMLTGEESLTSGDAFVGGHRISS-DVGKVRQRI 1458

  Fly    84 GFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFK-LLKELLQLPPARQMIKQCSGGQQRRL 147
            |:.||..||::.||.:|.:..:.|:.|:.:..|....: .|:.||..|.|.::::..|||.:|:|
Human  1459 GYCPQFDALLDHMTGREMLVMYARLRGIPERHIGACVENTLRGLLLEPHANKLVRTYSGGNKRKL 1523

  Fly   148 SFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITTHYIEEAKQANC--IGL 210
            |...|:|.:|.::.||||:.|:||:.|..:|| .|...|.|..|:|||:|.:||. :|.|  :.:
Human  1524 STGIALIGEPAVIFLDEPSTGMDPVARRLLWD-TVARARESGKAIIITSHSMEEC-EALCTRLAI 1586

  Fly   211 MRNGVLLAEDTPTNIMIKFGTQSIEDAFLILSQRQGNEDELAQIMDHNKNQALPAAVLPPE---V 272
            |..|......:|.::..|||:.....|.:   |.:|.::.|.:.... .:...|.:||..|   :
Human  1587 MVQGQFKCLGSPQHLKSKFGSGYSLRAKV---QSEGQQEALEEFKAF-VDLTFPGSVLEDEHQGM 1647

  Fly   273 IDTHEP 278
            :..|.|
Human  1648 VHYHLP 1653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 83/266 (31%)
P-loop_NTPase 4..222 CDD:304359 69/205 (34%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
ABCA3NP_001080.2 ABC2_membrane_3 <271..469 CDD:289468
CcmA 530..839 CDD:224054
ABC_subfamily_A 530..751 CDD:213230
ABC2_membrane_3 923..1261 CDD:289468
ABC_subfamily_A 1381..1602 CDD:213230 70/209 (33%)
drrA 1397..1692 CDD:130256 82/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.