DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and ABCA1

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_005493.2 Gene:ABCA1 / 19 HGNCID:29 Length:2261 Species:Homo sapiens


Alignment Length:231 Identity:69/231 - (29%)
Similarity:123/231 - (53%) Gaps:8/231 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEVRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLG 68
            |.::|..|.|  :...|:.::.|.:|...|.|...||.:|.||||.:|.:.|......|...:||
Human   899 VSIQNLVKVY--RDGMKVAVDGLALNFYEGQITSFLGHNGAGKTTTMSILTGLFPPTSGTAYILG 961

  Fly    69 AKPGEPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFKLLKELLQLPPAR 133
            .......|.: ...:|..||...|.:.:||:|.|:::.|:.||:::.::.:.:.:...:.||.::
Human   962 KDIRSEMSTI-RQNLGVCPQHNVLFDMLTVEEHIWFYARLKGLSEKHVKAEMEQMALDVGLPSSK 1025

  Fly   134 QMIK--QCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITT 196
            ...|  |.|||.||:||.|.|.:...:::||||||.|:||..|..||:.|::..:..  .:|::|
Human  1026 LKSKTSQLSGGMQRKLSVALAFVGGSKVVILDEPTAGVDPYSRRGIWELLLKYRQGR--TIILST 1088

  Fly   197 HYIEEAK-QANCIGLMRNGVLLAEDTPTNIMIKFGT 231
            |:::||. ..:.|.::.:|.|....:...:..:.||
Human  1089 HHMDEADVLGDRIAIISHGKLCCVGSSLFLKNQLGT 1124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 69/231 (30%)
P-loop_NTPase 4..222 CDD:304359 67/220 (30%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
ABCA1NP_005493.2 rim_protein 6..2236 CDD:130324 69/231 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1283..1312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.