DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and wht-5

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_502352.1 Gene:wht-5 / 178182 WormBaseID:WBGene00008950 Length:695 Species:Caenorhabditis elegans


Alignment Length:381 Identity:90/381 - (23%)
Similarity:153/381 - (40%) Gaps:93/381 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 VLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLN---GGEVVVLGAKPGEPGSGVPGSRV 83
            :|.:::.....|.:..::|:||.||||||:.:.|:...|   .|::::.|.   ...|.......
 Worm   118 ILKKIDGVARPGELTFIMGSSGAGKTTLLNILTGRNLKNIETDGDIMINGR---NMISNEMKKLS 179

  Fly    84 GFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFKLLKELLQLPPARQMIKQC--------- 139
            .::.|:...:..:||:||:.:..::...:.....|...::.|||.:    ..:|:|         
 Worm   180 AYVQQDDVFIGTLTVRETLRFAAKLRSPSALGATELDSIVDELLVM----MSLKKCENTKVGTMT 240

  Fly   140 ----SGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITTH--- 197
                |.|:::||:|||.::.||.:|..||||.|||..:..::...|.:.|...| .||.|.|   
 Worm   241 EKSLSRGERKRLAFACEILTDPPILFCDEPTSGLDSFMSHQVIKALRQLTIEGK-TVICTIHQPS 304

  Fly   198 -------------------YIEEAKQANCIGLMRNGVLLAE--DTPTNIMIKFGTQSIEDAFLIL 241
                               |...|||.:.. ..|.|..:.:  .:|.:.|.....:|.|      
 Worm   305 TSVYHMADQLILLSQGHVAYAGPAKQVDAF-FGRCGYPIPKFVSSPDHFMRVISHKSFE------ 362

  Fly   242 SQRQGNEDELAQIMDHNKNQALPAAVLPPEVI----DTHEP------NMPEKQPIPFEEPLNENR 296
                 .||      |:||.  :...||..:::    .||..      ..||..|..|.....   
 Worm   363 -----TED------DYNKR--IEKIVLEHDIMKKEQSTHSTLSSSRREHPETAPFTFPRTWT--- 411

  Fly   297 KKIFFTTKGRVKALMTKNFVQLFRQPSGIIFMLLFPIIQLTCFYLAIGKTPTNLEI 352
            .:.||        :..::.:||:|:.|    :||..:||.....:.||.|...|||
 Worm   412 AQFFF--------IFQRSSIQLWRERS----VLLVKLIQTLIMSIMIGSTYYGLEI 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 70/309 (23%)
P-loop_NTPase 4..222 CDD:304359 57/239 (24%)
ABC2_membrane_3 322..702 CDD:289468 11/31 (35%)
ABC2_membrane 469..664 CDD:279410
wht-5NP_502352.1 3a01204 88..695 CDD:273361 90/381 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.