DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and abt-2

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_490949.3 Gene:abt-2 / 171782 WormBaseID:WBGene00000020 Length:2146 Species:Caenorhabditis elegans


Alignment Length:286 Identity:80/286 - (27%)
Similarity:140/286 - (48%) Gaps:38/286 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVEVRNGYKYYGSKSNPKIV-LNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVV 66
            |:.|||..|.|    ||::: :..::..|..|..:||||.:|.||||..:.:..:.|...|.:.:
 Worm  1801 ALIVRNLAKAY----NPELLAVKGISFAVEPGECFGLLGLNGAGKTTTFAMLTAKIRPGHGSIEM 1861

  Fly    67 LGAKPGEPGSGVPGS--------RVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIREKFKLL 123
            ...:..      .||        ::|:.||..||..:::.:|.:.::.||.|:...:|......|
 Worm  1862 QNTRIN------TGSFSDVRNFQQLGYCPQFDALNMKLSTRENLKFYARIRGIVPTQIDSIIDRL 1920

  Fly   124 KELLQLPP-ARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRN 187
            ...|.|.| |.......|||.:|:||.|.|::..|.|:.||||:.|:||..::.:|..:....::
 Worm  1921 LIALHLRPYANTQTSSLSGGNRRKLSVAVALVSQPSLIFLDEPSAGMDPGSQQFLWKVIERLCKS 1985

  Fly   188 SKLAVIITTHYIEEAKQANC--IGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLILSQRQG---N 247
            .| ||::|:|.:||. :|.|  |.:|..|.:.......::..|:|..|      :|:.:.|   |
 Worm  1986 GK-AVVLTSHSMEEC-EALCTRIAIMDRGRIRCLGGKQHLKSKYGKGS------MLTMKMGKDEN 2042

  Fly   248 EDELAQIM-----DHNKNQALPAAVL 268
            ..|:|.||     |.::.:|:..:.:
 Worm  2043 AKEIAGIMRSKLGDGSRVEAIHCSTI 2068

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 80/286 (28%)
P-loop_NTPase 4..222 CDD:304359 67/229 (29%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
abt-2NP_490949.3 rim_protein 39..2117 CDD:130324 80/286 (28%)
ABC_subfamily_A 929..1134 CDD:213230
ABC_subfamily_A 1802..2024 CDD:213230 67/233 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.