DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and ABCA13

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_011513432.1 Gene:ABCA13 / 154664 HGNCID:14638 Length:5059 Species:Homo sapiens


Alignment Length:255 Identity:70/255 - (27%)
Similarity:129/255 - (50%) Gaps:13/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVV---LGAKPG 72
            |:|.......|.:..:::.:.:|..:||||.:|.||:|....:.|:..|..|..::   :|....
Human  4726 KHYRRFFQNIIAVQDISLGIPKGECFGLLGVNGAGKSTTFKMLNGEVSLTSGHAIIRTPMGDAVD 4790

  Fly    73 EPGSGVPGSRVGFMPQEIALVEEMTVKETIFYFGRIYGLTDERIRE-KFKLLKELLQLPPARQMI 136
            ...:|..|..:|:.||:.||.|.:|..|.::|:..:.|:..:.|.| ...|::.|.....|.:.:
Human  4791 LSSAGTAGVLIGYCPQQDALDELLTGWEHLYYYCSLRGIPRQCIPEVAGDLIRRLHLEAHADKPV 4855

  Fly   137 KQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIITTHYIEE 201
            ...|||.:|:||.|.|::..|::|:||||:.|:||..:..:|..:::..|.. .|.::|:|.:||
Human  4856 ATYSGGTKRKLSTALALVGKPDILLLDEPSSGMDPCSKRYLWQTIMKEVREG-CAAVLTSHSMEE 4919

  Fly   202 AKQANC--IGLMRNGVLLAEDTPTNIMIKFGTQSIEDAFLILSQRQGNEDELAQIMDHNK 259
            . :|.|  :.:|.||......:|.:|..:||     |.:.:........::...:.||.|
Human  4920 C-EALCTRLAIMVNGSFKCLGSPQHIKNRFG-----DGYTVKVWLCKEANQHCTVSDHLK 4973

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 70/255 (27%)
P-loop_NTPase 4..222 CDD:304359 62/216 (29%)
ABC2_membrane_3 322..702 CDD:289468
ABC2_membrane 469..664 CDD:279410
ABCA13XP_011513432.1 rim_protein 3068..5049 CDD:130324 70/255 (27%)
ABC_subfamily_A 3842..4062 CDD:213230
ABC_subfamily_A 4719..4945 CDD:213230 63/220 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.