DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11147 and ABCA7

DIOPT Version :9

Sequence 1:NP_608954.1 Gene:CG11147 / 33803 FlyBaseID:FBgn0031734 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_024307083.1 Gene:ABCA7 / 10347 HGNCID:37 Length:2151 Species:Homo sapiens


Alignment Length:540 Identity:133/540 - (24%)
Similarity:233/540 - (43%) Gaps:80/540 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VEVRNGYKYYGSKSNPKIVLNQLNMNVMRGSIYGLLGASGCGKTTLLSCIVGQRRLNGGEVVVLG 68
            |.||:..|.:  ..:|:..|..|:::..:|.|...||.:|.||||.||.:.|....:||...:||
Human   807 VSVRSLEKRF--PGSPQPALRGLSLDFYQGHITAFLGHNGAGKTTTLSILSGLFPPSGGSAFILG 869

  Fly    69 AKPGEPGSGVPGSR--VGFMPQEIALVEEMTVKETIFYFGRIYGLTDERI-REKFKLLKELLQLP 130
               .:..|.:...|  :|..||...|.:.:||.|.::::||:.||:...: .|:.:||:::..:.
Human   870 ---HDVRSSMAAIRPHLGVCPQYNVLFDMLTVDEHVWFYGRLKGLSAAVVGPEQDRLLQDVGLVS 931

  Fly   131 PARQMIKQCSGGQQRRLSFACAMIHDPELLILDEPTVGLDPMLREKIWDFLVETTRNSKLAVIIT 195
            ......:..|||.||:||.|.|.:...:::||||||.|:||..|..||:.|::......|  |::
Human   932 KQSVQTRHLSGGMQRKLSVAIAFVGGSQVVILDEPTAGVDPASRRGIWELLLKYREGRTL--ILS 994

  Fly   196 THYIEEAK-QANCIGLMRNGVLLAEDTPTNIMIKFGT---QSIEDAFLILSQRQGNEDELAQIMD 256
            ||:::||: ..:.:.::..|.|....:|..:....|:   .::..|.|.|:..:..:.::...:|
Human   995 THHLDEAELLGDRVAVVAGGRLCCCGSPLFLRRHLGSGYYLTLVKARLPLTTNEKADTDMEGSVD 1059

  Fly   257 ---HNKNQALPAAVLPPEVIDTHEPNMPEKQPIPFEEPLNENRKKIFFTTKGRVKALMTKNFVQL 318
               ..||.:..:.|..|:::...:..:|..:.:  ||..:|....:.:|      .....:|..|
Human  1060 TRQEKKNGSQGSRVGTPQLLALVQHWVPGARLV--EELPHELVLVLPYT------GAHDGSFATL 1116

  Fly   319 FRQPSGIIFMLLFPIIQLTCFYLAIGKTPTNLEIGVYSGEVENYGECFDENLVTVYKDSDNESCL 383
            ||:....:..|     :||.:    |.:.|:|| .::...||   ||..:.      |.::.|| 
Human  1117 FRELDTRLAEL-----RLTGY----GISDTSLE-EIFLKVVE---ECAADT------DMEDGSC- 1161

  Fly   384 FNKLSCRYIRVLGDDVATRKYYASEADALNDAKRATTVGYLHFAQNFSDSILSVMEDGIHSSDGA 448
             .:..|  ..:.|.||..|.....:..||.:.:.|.                |..|....|...|
Human  1162 -GQHLC--TGIAGLDVTLRLKMPPQETALENGEPAG----------------SAPETDQGSGPDA 1207

  Fly   449 VDHAELSIHIDMTDQQV-AYFMQRKL---RDKFSTFMRSVVKDCNVSTAIV---------DLPVQ 500
            |...:   ...:|.||: |..::|.|   |.:...|.:.|:....|..|:|         ..|..
Human  1208 VGRVQ---GWALTRQQLQALLLKRFLLARRSRRGLFAQIVLPALFVGLALVFSLIVPPFGHYPAL 1269

  Fly   501 FQEPIFGSTDIEFQQYCAPG 520
            ...|......:.|....|||
Human  1270 RLSPTMYGAQVSFFSEDAPG 1289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11147NP_608954.1 CcmA 1..282 CDD:224054 79/287 (28%)
P-loop_NTPase 4..222 CDD:304359 69/221 (31%)
ABC2_membrane_3 322..702 CDD:289468 45/212 (21%)
ABC2_membrane 469..664 CDD:279410 14/64 (22%)
ABCA7XP_024307083.1 rim_protein 1..2114 CDD:130324 133/540 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0059
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.