DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14006 and Nemp2

DIOPT Version :9

Sequence 1:NP_001260104.1 Gene:CG14006 / 33802 FlyBaseID:FBgn0031733 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_038940060.1 Gene:Nemp2 / 503257 RGDID:1560421 Length:461 Species:Rattus norvegicus


Alignment Length:479 Identity:91/479 - (18%)
Similarity:145/479 - (30%) Gaps:173/479 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YAASSFVNWDNVFYEQQATYLRPGEPHIQEGQTLLNMLYVNNQVQVYCQPP---------TAFSM 70
            |...|.:.|..::...|.|...||         ||:::|:..:..  ||..         ...:.
  Rat    54 YNQHSQIEWTYMWSTVQVTVTSPG---------LLSIVYITGRHT--CQHTETILSFLKCVTHNF 107

  Fly    71 WNVFQSNRLRLQIAAGEDYTQYKGATVREVHHAHSQLDECHEGKPLGHSAADEPRIVPMATYEHS 135
            |...::..:.:.      ::.| |.||            |...||:|          .:.||..|
  Rat   108 WTAEEAKEVTIV------FSPY-GETV------------CFSVKPVG----------SLLTYAVS 143

  Fly   136 CYGIYTSKPFVLTLEVISFDLERVSQFTFGIVLWLSCPLLADSLLFFYCSAAALGAHLAGLLAVA 200
                       :...|:.|.|..|  |..||.|:.....|:.|.:|:|.|...||.    |:.:.
  Rat   144 -----------VNRNVVDFRLFLV--FATGIFLFFYAKTLSQSPVFYYSSGTVLGI----LMTLV 191

  Fly   201 ATLMASDGE--RYLRLGTLKV---------------NFK-LVLNERPTVITLALVSGAWLLKSAS 247
            ..|:.:...  :|...|.|.:               |.| |....|..|:...||.|.       
  Rat   192 FVLLMTKKHIPKYSTFGALMIGCWFASVYVLCQLMENLKWLWCGNRIYVLGYVLVVGL------- 249

  Fly   248 QRCSF------------------LWRCTLFRRLHHRLLKGTSYLLILTASDHRGFG-MTCLMLLM 293
              |||                  :|           .|:..|.:|:.|......|. ...::||:
  Rat   250 --CSFSACYSRGPPADEGSRDLLMW-----------ALRFLSLVLVYTGMAISQFAYAVMILLLL 301

  Fly   294 PWP-----ELLTVIRWLKTLYACYKRGSVKPMVQVEIENQ-------------------DVPYQD 334
            .|.     ...:.:||....:...:...|:.:...|...|                   |.|   
  Rat   302 SWTRHYLLRAFSCLRWKVRQWFATRALVVRYLTDDEYREQAEAETASALEELRQACCRPDFP--- 363

  Fly   335 SYLRIVRSEYDNR---------SSE---SSGFSRS-FSQNKHNMGFYREQEDQDNALIYESRRPT 386
            |:|.:.|.:...:         .||   .||..|: ::|.|...|     |......:...|:|.
  Rat   364 SWLAVSRLQAPKKRGAKVLGLCGSEQGIDSGTRRTHYTQKKQGRG-----EGMARYSLCLMRKPA 423

  Fly   387 ERNCFNR-----CHQCTPTRSPRP 405
            ..:.|.|     .||..|.:...|
  Rat   424 HVSTFPRLSTGKSHQLFPVQVQMP 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14006NP_001260104.1 DUF2215 146..345 CDD:287228 50/259 (19%)
Nemp2XP_038940060.1 NEMP 142..376 CDD:402020 51/273 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13598
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.