DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14006 and Nemp2

DIOPT Version :9

Sequence 1:NP_001260104.1 Gene:CG14006 / 33802 FlyBaseID:FBgn0031733 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001136119.1 Gene:Nemp2 / 227094 MGIID:2444113 Length:421 Species:Mus musculus


Alignment Length:415 Identity:83/415 - (20%)
Similarity:126/415 - (30%) Gaps:159/415 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YAASSFVNWDNVFYEQQATYLRPGEPHIQEGQTLLNMLYVNNQVQVYCQPPTAF---------SM 70
            |...|.:.|..::...|.|...||         |||::|:.....  ||...:.         :.
Mouse    54 YNQHSQIQWTYMWSTVQVTVTSPG---------LLNIVYITGSHN--CQHTESILSFIKCVTHNF 107

  Fly    71 WNVFQSNRLRLQIAAGEDYTQYKGATVREVHHAHSQLDECHEGKPLGHSAADEPRIVPMATYEHS 135
            |...::..:.:.      ::.| |.||            |...||:|       |::|       
Mouse   108 WAPEEAEEITIV------FSPY-GETV------------CFSVKPVG-------RLLP------- 139

  Fly   136 CYGIYTSKPFVLTLEVISFDLERVSQFTFGIVLWLSCPLLADSLLFFYCSAAALGAHLAGLLAVA 200
             |.:..|:      .::.|.|..|  |..||.|:|....|:.|.:|:|.|...||..:.   .|.
Mouse   140 -YIVSVSR------NIVDFKLFLV--FVTGIFLFLYAKTLSQSPVFYYSSGTVLGILMT---LVF 192

  Fly   201 ATLMASDG-ERYLRLGTLKV---------------NFK-LVLNERPTVITLALVSGAWLLKSASQ 248
            ..|||... .:|...|.|.:               :.| |....|..::...:|.|.        
Mouse   193 VLLMAKKHIPKYSTFGALMIGCWFASVYVLCQLMEDLKWLWYGNRMYILGYVVVVGL-------- 249

  Fly   249 RCSF------------------LWRCTLFRRLHHRLLKGTSYLLILTASDHRGFGMTCL-MLLMP 294
             |||                  :|...||           |..|:.|......|....| :||..
Mouse   250 -CSFAACYSHGPLADEGSRDLLMWTLRLF-----------SLALVYTGVAAPQFAYAVLIVLLFS 302

  Fly   295 WPELLTVIRWLKTLYACYKRGSVKPMVQVEIENQDVPYQDSYLRIVRSEYDNRSSESSGFSRSFS 359
            |.     :.:|...:: |.|..::|....|      |....||.      |:.            
Mouse   303 WS-----LHYLLRAFS-YLRWKMRPWFTAE------PQVARYLT------DDE------------ 337

  Fly   360 QNKHNMGFYREQEDQDNALIYESRR 384
                    ||||.:...|...|..|
Mouse   338 --------YREQAEAATARALEELR 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14006NP_001260104.1 DUF2215 146..345 CDD:287228 49/234 (21%)
Nemp2NP_001136119.1 DUF2215 142..389 CDD:287228 58/282 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13598
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.