DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and GXYLT2

DIOPT Version :9

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:NP_001073862.1 Gene:GXYLT2 / 727936 HGNCID:33383 Length:443 Species:Homo sapiens


Alignment Length:273 Identity:53/273 - (19%)
Similarity:87/273 - (31%) Gaps:115/273 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 VSFHVYFPNQHMPEYVPYDEAEVLMYPHMCTLANGSLVSPLYTQIPTTDSY-KSRANLTYPINVG 254
            :.||::..:...||:    :.::..:|                     ||| |...:..|||.. 
Human   139 IQFHIFTEDSLKPEF----DKQLRQWP---------------------DSYTKKFEHRIYPITF- 177

  Fly   255 RNIARLATNTHFIFACDIELYPSVGFVDQFLDMVARNHSVLALDPRQRRRVYPLPVFEIETGAKV 319
                                  |||...::..:         ..|...:|:: |||...:..:.:
Human   178 ----------------------SVGNPQEWKKL---------FKPCAAQRLF-LPVILKDVDSLL 210

  Fly   320 PVDKD-----------ELLALYRKQQAQVFHLKLCPTCHTIPGQEEWLNRTSRADDHLHVFSKA- 372
            .||.|           :||.|:...|...    :.|. |.|| :..|.:|.:|     |.|..: 
Human   211 YVDTDVLFLRPVDDIWKLLRLFNSTQLAA----MAPE-HEIP-KIGWYSRFAR-----HPFYGSA 264

  Fly   373 -------------LRKWKFR--------AWEPFYVSDNTEPLFDE---RVTWEGQSNKRIQVSYY 413
                         :|..:|:        |||     |...||:.:   .:||..|....| :.|:
Human   265 GVNSGVMLMNLTRIRSTQFKNSMIPTGLAWE-----DMLYPLYQKYKNAITWGDQDLLNI-IFYF 323

  Fly   414 ---CSQVSVSQCN 423
               |..|...|.|
Human   324 NPECLYVFPCQWN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 53/273 (19%)
GXYLT2NP_001073862.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..84
GT8_like_2 110..413 CDD:133052 53/273 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.