DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and Gxylt2

DIOPT Version :9

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_001066466.1 Gene:Gxylt2 / 688618 RGDID:1586482 Length:444 Species:Rattus norvegicus


Alignment Length:136 Identity:31/136 - (22%)
Similarity:54/136 - (39%) Gaps:31/136 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 ALDPRQRRRVYPLPVFEIETGAKVP--VDKDELLALYRKQQAQVFHLKLCPTCHTIPGQEEWLNR 358
            |..||..||..|    .:..||..|  ..:.:|    .::..:|..|      |::| .|.|::.
  Rat    64 AAGPRFPRRRPP----RLRPGASRPRAASRGKL----ARRSGEVRSL------HSVP-PELWIHL 113

  Fly   359 T-----SRADDHLHVFSKAL----RKWKFRAWEPFYVSDNTEPLFDERV-TWEGQSNKRIQVSYY 413
            .     :|.::.|.:...|:    ||.:|.    .:..|..:|.||::: .|.....|:.:...|
  Rat   114 AVVACGNRLEETLVMLKSAVLFSHRKMRFH----IFTEDALKPEFDKQLRQWPDSYTKKFEHKLY 174

  Fly   414 CSQVSV 419
            ....||
  Rat   175 PITFSV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..485 CDD:290607 31/136 (23%)
Gxylt2XP_001066466.1 GT8_like_2 111..414 CDD:133052 15/74 (20%)
RfaJ 127..396 CDD:224359 13/58 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339845
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3765
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.