DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11149 and xxylt1

DIOPT Version :10

Sequence 1:NP_608952.2 Gene:CG11149 / 33800 FlyBaseID:FBgn0031732 Length:493 Species:Drosophila melanogaster
Sequence 2:XP_005155910.1 Gene:xxylt1 / 449721 ZFINID:ZDB-GENE-120521-2 Length:387 Species:Danio rerio


Alignment Length:135 Identity:30/135 - (22%)
Similarity:52/135 - (38%) Gaps:27/135 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RLWPVLILFNVALLLVWRNLQQAQKLAASSNTGGQKSVGLLLSNESNPSRFSANFHLANDQHPKI 77
            |.:.:::|...||.:|......::|...||.|...|..    ....|.:|..|:  |:.|..|..
Zfish    18 RSYQIVLLLAAALAVVAFYYFGSEKQNFSSTTKRIKET----QASHNSNRDDAD--LSIDIQPGH 76

  Fly    78 IRREDSA------RTKELRSLLKCR--DRSLRFER---------LQHGEFW----LLQNLVMGRK 121
            :.....|      :.|...:|:...  |:||..::         ::||.|.    |:.:.|....
Zfish    77 LESRPGAGAELEGKPKRFHALMMFTKVDKSLSLQQKFQTAMRSMVKHGRFLEDEILVLHYVSDLG 141

  Fly   122 SREVG 126
            |:|.|
Zfish   142 SQEFG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11149NP_608952.2 Glyco_transf_49 130..486 CDD:464027
xxylt1XP_005155910.1 Glyco_tranf_GTA_type 119..>350 CDD:472172 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.